KEGG   Bacillus sp. JS: MY9_2588Help
Entry
MY9_2588          CDS       T02027                                 

Definition
(GenBank) hypothetical protein
  KO
K09710  ribosome-associated protein
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bjs03009]
    MY9_2588
Ribosome biogenesis [BR:bjs03009]
 Prokaryotic type
  Other maturation factors
   MY9_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsfS
Motif
Other DBs
NCBI-ProteinID: AFI29121
UniProt: I0F6L5
Position
complement(2548611..2548967)
Genome map
AA seq 118 aa AA seqDB search
MNQKAILKLAAAACDDKRAEDILALDMEGISLVADYFLICHGNSDKQVQAIAREIKDQAD
ENGIQVKKMEGFDEARWVLVDLGDVIVHVFHKDERSYYNLEKLWGDAPLADLDLGMNQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaaggccattttaaagctcgcagctgcggcatgcgatgataaacgggcagag
gatattttagcactggatatggaaggcatttctctagttgctgattattttttgatctgc
cacggaaattcagataaacaggtgcaggcgattgcccgtgaaatcaaggatcaggctgat
gaaaacggcattcaagtcaaaaagatggaaggctttgatgaagcaagatgggtgctcgtt
gaccttggcgatgtgattgttcatgtcttccacaaggacgaaagaagctactataacctt
gaaaagctgtggggagacgctccgctcgcagatcttgaccttggaatgaaccaatga

DBGET integrated database retrieval system