KEGG   Bacillus sp. JS: MY9_2775Help
Entry
MY9_2775          CDS       T02027                                 

Definition
(GenBank) GTP-binding protein
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bjs03009]
    MY9_2775
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     MY9_2775
Ribosome biogenesis [BR:bjs03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   MY9_2775
 Prokaryotic type
  GTPases
   MY9_2775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG DUF1967 MMR_HSR1 FeoB_N RsgA_GTPase Arf MMR_HSR1_C MeaB AAA_18 GTP_EFTU PduV-EutP MMR_HSR1_Xtn
Motif
Other DBs
NCBI-ProteinID: AFI29308
UniProt: I0F752
Position
complement(2715929..2717215)
Genome map
AA seq 428 aa AA seqDB search
MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRY
KKHFKAIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGG
RGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKSTLLSVVSS
AKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVI
VHVIDMSGLEGRDPYDDYVTINQELSEYNLRLTERPQIIVANKMDMPEAAENLEAFKEKL
TDDYPVFPISAVTREGLRELLFEVANQLENTPEFPLYDEEELTQNRVMYTMENEEVPFNI
TRDPDGVFVLSGDSLERLFKMTDFSRDESVKRFARQMRGMGVDEALRERGAKDGDIIRLL
EFEFEFID
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtagatcaggtcaaagtatatgtaaaaggcggcgacggcggcaacgggatggtt
gcgtttcgccgtgaaaagtatgtgccgaaaggcggccctgccggcggcgacggaggaaag
ggaggagacgtcgtttttgaagtggatgaaggtctccgcaccctaatggattttagatac
aaaaaacactttaaagcgattcgcggcgagcatggcatgtccaaaaaccagcacggacga
aatgctgatgatatggtcattaaagttccgccaggcaccgttgtgacagacgatgataca
aaacaggtcatcgctgatttaacagagcacggacagcgggctgtcattgcaagaggcgga
agaggcggaagagggaatagccgctttgctacaccggctaatcccgcgcctcagctttca
gaaaacggcgagccgggaaaagaacgctacattgttcttgaattaaaagtgcttgcagat
gtcggactcgtcgggttcccgagcgtaggaaaatcgacgttgctgtctgttgtctcatct
gcaaaaccgaaaattgcggactatcactttacaacgcttgtgccgaatctcggtatggtt
gaaacggatgacggacgcagctttgtaatggcagatttaccaggactgattgaaggcgca
caccaaggcgtcggacttggccatcagtttttgcgccatattgaacggacacgagttatt
gttcatgtcattgacatgtccggcttagaaggccgcgatccgtatgatgattatgtcacg
attaatcaggaactgagcgagtacaatctgcgactcactgagcgtccgcaaattatcgtt
gcaaataaaatggacatgccggaggctgcagaaaatcttgaagcctttaaagaaaaactg
acggatgattatccggtattcccgatcagcgcggtgacaagagaaggccttcgcgagctt
ctgtttgaggttgccaatcagcttgagaacacaccggagttcccgctgtatgatgaggaa
gagcttacacaaaaccgtgtcatgtacacgatggaaaatgaagaagtgccatttaacatt
acacgcgatccagacggtgtatttgtgctttcaggagatagccttgagcgattattcaag
atgactgatttctcacgtgatgaatcggttaaacggtttgcgagacagatgcgcggaatg
ggtgttgatgaagcactcagagaacgcggagccaaggatggagatattatcaggcttctt
gaatttgaatttgaatttattgattaa

DBGET integrated database retrieval system