KEGG   Bacillus sp. JS: MY9_2956Help
Entry
MY9_2956          CDS       T02027                                 

Definition
(GenBank) AcsA1
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00010  Glycolysis / Gluconeogenesis
bjs00620  Pyruvate metabolism
bjs00640  Propanoate metabolism
bjs00680  Methane metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_2956
   00620 Pyruvate metabolism
    MY9_2956
   00640 Propanoate metabolism
    MY9_2956
  Energy metabolism
   00680 Methane metabolism
    MY9_2956
Enzymes [BR:bjs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MY9_2956
Lipid biosynthesis proteins [BR:bjs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MY9_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFI29489
UniProt: I0F7N3
Position
complement(2888006..2889595)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAVLA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTAIKPGSMGKPTPGNQVEIINEDGEVC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKIL
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctatgcaatataatttagtgaatgaaatggaa
aagttcagtgccgctggacaaaaaaccgctcttctatgggaggacgagtcgggcaagcaa
gaatcatggtcttatgaaaagctgatggaagaaacaaataaaatcggagcggtcttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgctagaagcc
tatgcagtttatttggctatcctgaaatctggaatggttgtcattccgtgctctgaaatg
cttcgtgcgaaggatcttgaataccgaattgaacatgcagaggtaaaaggcgccattgtc
tattccgaatttatcggcgctttccgtgatgtcagtacggctgacaaactgattacactg
tctattggtgagaatgatgccggctggaaaaatctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttgtcttatacttccggg
acaacaggtcagccgaaaggtgttgtacatacacacggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgatatttctgaaaaggatatcgtctgggcgactgctgcc
ccaggctggcaaaagtgggtgtggagtccatttttagcggtgctaggcagcggagcaacg
ggttttgtgtaccacggcagattcaaagcagaaaaatatttagagcttttaaaccgctac
aaaatcaatgttttctgctgtacgccgacagaatatcgcttaatggcgaaggtcgaaggc
ttggaccgttttgatctttctgcccttcacagcgctgtttccgcaggcgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatacggc
caaacagaaagcacgcttttagtcggtgttttgaaagatacggctattaaaccgggaagc
atgggaaaaccaacaccgggaaatcaggtggaaatcattaatgaagacggtgaagtctgc
aaacctggtgaggttggcgatatcgctgttcacctcagcacgcctgcgctctttaaagaa
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcgagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatc
attatcagctccggctacacgatcgggccattcgaggtggaagacgcgcttgttaagcac
cctgaagtaaaagagtgtgctgttgtcgcaagccctgatgaaatcagaggctccatcgtt
aaggcatacgttgtcctgcaaaatcatgaaaaacgaagtgatgagcttgtcaaaatactg
cagaatcatgtgaagacgattaccgctccatacaaatacccaagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system