KEGG   Bacillus sp. JS: MY9_3059Help
Entry
MY9_3059          CDS       T02027                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00010  Glycolysis / Gluconeogenesis
bjs00020  Citrate cycle (TCA cycle)
bjs00620  Pyruvate metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
Module
bjs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_3059
   00020 Citrate cycle (TCA cycle)
    MY9_3059
   00620 Pyruvate metabolism
    MY9_3059
Enzymes [BR:bjs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     MY9_3059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33
Motif
Other DBs
NCBI-ProteinID: AFI29592
UniProt: I0F7Y6
Position
2994213..2995796
Genome map
AA seq 527 aa AA seqDB search
MNSVDLTADLQALLTSPNVRHNLSAAQLTEKVLSRNEGILTSTGAVRATTGAYTGRSPKD
KFIVEEESTKNKIDWGPVNQPISEEAFDRLYTKVVSYLKQRDELFVFEGFAGADEKYRLP
ITVVNEFAWHNLFARQLFIRPEGNDKKTVEQPFTILSAPHFKADPKTDGTHSETFIIVSF
EKRTILIGGTEYAGEMKKSIFSIMNFLLPERDILSMHCSANVGEKGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDTGVFNIEGGCYAKCIHLSEEKEPQIFNAIRFGSVLENVVV
DEDTREANYDDSFYTENTRAAYPIHMIDNIVTPSMAGHPSAIVFLTADAFGVLPPISKLT
KEQAMYHFLSGYTSKLAGTERGVTSPETTFSTCFGSPFLPLPAHVYAEMLGKKIDEHGAD
VFLVNTGWTGGGYGTGERMKLSYTRAMVKAAIEGKLEDAEIITDDIFGLHIPAHVPGVPD
HILQPENTWANKEEYREKAFYLANEFKENFKKFAHTDAIAQAGGPLV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagttgatttgaccgctgatttacaagccttattaacaagtccaaatgtgcgt
cataatttatcagcagcacagctaacagaaaaagtactctcccgaaacgaaggcatttta
acatccacgggtgctgttcgcgcgacaacaggcgcttacacaggacgttcacctaaagat
aaattcatcgtggaggaagaaagcacgaaaaataagatcgattggggcccggtgaatcag
ccgatttcagaagaagcgtttgatcggctttatacgaaagttgtcagctacctgaaacag
cgagatgagctgtttgttttcgaaggatttgcgggagcagacgagaaatacaggctgccg
atcactgtcgtaaatgagttcgcatggcacaatttatttgcgcggcagctgttcatccgt
ccggaaggcaatgataagaaaacagttgagcagccgttcaccattctttctgctccgcat
ttcaaagcggacccaaaaacagacggcactcattccgaaacgtttattattgtctctttc
gaaaaacggacgattttaatcggaggaacagagtatgccggagaaatgaagaagtctatt
ttctccattatgaatttcctgctgcctgaaagagacattttatccatgcactgctccgcc
aatgtcggtgaaaaaggtgatgtcgcccttttcttcggactgtcaggaacaggaaagacc
actctttcagccgatgctgaccgcaagctgatcggtgacgatgaacatggctggtctgat
acaggcgtctttaatatcgaaggcggatgctacgctaagtgcattcacttaagcgaggag
aaggaacctcagatctttaacgcaattcgtttcggatcagttctcgagaatgtcgttgtt
gatgaagacacacgtgaagccaattatgatgattccttctatactgaaaacacgcgggca
gcttacccgatccatatgattgataacatcgtgactccaagcatggcaggccatccgtct
gcaattgtatttttgacggctgatgccttcggagtcctgccgccgatcagcaaactgacg
aaggaacaggcgatgtaccatttcttgagcggttacacgagcaagcttgccggaactgaa
cgaggtgtgacgtcacctgaaacgacgttctccacttgcttcggctcaccgttcctgccg
cttcctgctcacgtctatgctgaaatgctcggcaaaaagatcgatgaacacggcgcagac
gttttcttggtcaataccggctggaccgggggcggctatggcactggcgaacgaatgaag
ctttcttacacaagagcaatggtcaaagcagcgattgaaggtaaattagaggatgcagaa
atcataactgacgatatttttggcctgcacatcccggctcatgttcctggcgttcctgat
cacatccttcagcctgaaaacacgtgggccaacaaggaagaatacagagaaaaggcattc
taccttgcaaatgaattcaaagagaattttaaaaagttcgcacatacagatgccattgca
caggcaggcggccctctcgtttaa

DBGET integrated database retrieval system