KEGG   Bacillus sp. JS: MY9_4150Help
Entry
MY9_4150          CDS       T02027                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00010  Glycolysis / Gluconeogenesis
bjs00030  Pentose phosphate pathway
bjs00051  Fructose and mannose metabolism
bjs00680  Methane metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
Module
bjs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_4150
   00030 Pentose phosphate pathway
    MY9_4150
   00051 Fructose and mannose metabolism
    MY9_4150
  Energy metabolism
   00680 Methane metabolism
    MY9_4150
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MY9_4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AFI30682
UniProt: I0FB26
Position
4029556..4031481
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKAALNEWYKETINRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYAGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKADDNRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLHGKTYQLENTCFATVNP
EQPDELLEEEAEVINKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIDDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacctagatctactcgcgcaaaaatacgattgtgaagaaaaagtggta
acagaaatcattaatttgaaagcgatattgaacctgccaaagggcactgagcattttgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcgcaatggttcaggacga
gtcaaagagaagatacgcgacatctttagcggtgtcatttacgatagagaaatcgatgaa
ttagcggcattggtctattatccggaagacaagctgaagttaatcaaacatgactttgat
gcgaaagcggcattaaacgagtggtataaagaaacgattaatcgaatgattaagctcgtt
tcttattgctcctccaagtatacccgctccaaactgcgcaaagcactgcctgcccagttt
gcttatattacggaggagctgctatacaaaacagaacaagctggcaacaaggagcaatat
tactccgaaatcattgatcagatcattgagcttggccaagccgataagctgatcaccggc
cttgcttacagcgttcagcggctggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccgcagccagatagaattatggaagaactgatcaactatcattctgtcgat
attcagtggggaaatcacgatgtcctttggatcggcgcctatgccggttccaaagtgtgc
ctggccaatattatccgcatctgtgcccgctacgacaacctggatattattgaggacgtg
tacggcatcaacctgagaccgctgctaaacctggccgaaaaatattatgacgataatcca
gcgttccgtccaaaagcagacgacaacaggccagaggatgagattaagcaaatcaccaaa
atccatcaagcgattgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaatatggaggaacggctgttattagagaaaatagattatgacaaaaacgaa
atcacgctgcacggaaaaacatatcaactggaaaacacctgctttgcgacggtgaatccg
gaacagccagatgagctattagaggaagaagcagaagtcataaacaagctgctgttctct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttgattcatggctgtattcctgtcgatgaaaatggc
aatatggaaacgatgatgattgacgataaaccgtatgcgggccgtgagctgctcgatgta
tttgaacgattcttacgggaagcctttgctcacccggaagaaaccgatgacctggcgact
gatatggcctggtatttatggacaggcgagtactcctccctcttcggaaaacgcgccatg
acgacatttgagcgttatttcattaaagagaaggaaacgcataaagaaaagaaaaacccc
tattattatttacgcgaggacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcatcaacggccatacacctgtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgacgtctta
acggtgaaacgattagtggacaaagagcttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggaactgctgcaagaggttgcgattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system