KEGG   Bacillus sp. JS: MY9_4156Help
Entry
MY9_4156          CDS       T02027                                 

Definition
(GenBank) rRNA large subunit methyltransferase
  KO
K00783  23S rRNA (pseudouridine1915-N3)-methyltransferase [EC:2.1.1.177]
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bjs03009]
    MY9_4156
Enzymes [BR:bjs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.177  23S rRNA (pseudouridine1915-N3)-methyltransferase
     MY9_4156
Ribosome biogenesis [BR:bjs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MY9_4156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOUT_MTase
Motif
Other DBs
NCBI-ProteinID: AFI30688
UniProt: I0FB32
Position
complement(4041711..4042190)
Genome map
AA seq 159 aa AA seqDB search
MNINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKAPENLSDQDMKIIKDKEG
DRILSKISPDAHVIALAIEGKMKTSEELADTIDKLATYGKSKVTFVIGGSLGLSDAVMKR
ADEKLSFSKMTFPHQLMRLILVEQIYRAFRINRGEPYHK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcaatattgtgacaatcggaaaactaaaagaaaaatacctcaagcaaggcatt
gaagaatacaccaaacgactttcggcctacgcaaaaatcgacatcatcgaactcccggac
gaaaaagcgccggaaaacctaagcgaccaggacatgaaaatcataaaagacaaagaaggc
gaccgcatcctatccaaaatcagccccgacgcccacgtcatcgccctcgccatcgaagga
aaaatgaaaacatccgaagaactagccgatacaatagataagctggctacatatggaaaa
agcaaagtcaccttcgtcatcggcggctcacttggattgagcgacgcagtgatgaagcga
gcggatgaaaagctgtcgttttcaaagatgacgtttcctcatcagttgatgcggcttatt
ctggtggagcagatttatcgggcttttcggattaatcgtggggagccttatcataaatag

DBGET integrated database retrieval system