KEGG   Bacillus sp. JS: MY9_4159Help
Entry
MY9_4159          CDS       T02027                                 

Definition
(GenBank) hypothetical protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00625  Chloroalkane and chloroalkene degradation
bjs00680  Methane metabolism
bjs01100  Metabolic pathways
bjs01120  Microbial metabolism in diverse environments
bjs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MY9_4159
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MY9_4159
Enzymes [BR:bjs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MY9_4159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc FAD_binding_3 PALP FAD_binding_2 Pyr_redox_3 FAD_oxidored 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFI30691
UniProt: I0FB35
Position
complement(4043075..4044301)
Genome map
AA seq 408 aa AA seqDB search
MGGMALTGNKAVVYKGKGNVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNI
CGSDQHMVRGRTTAPDGLVLGHEITGEVIDTGRDVEFIKKGDIVSVPFNIACGRCVMCKT
QKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLT
MLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQ
ARSFGCETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMD
VTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLM
KAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaatggcgttgacaggaaacaaagcggttgtgtacaaaggcaaaggaaacgtg
gcggtggaggatatcggttatccggagttaatcttaagggacgggcccggcgtcccgaag
gcaaatgtgaatcgaaaatgtgagcatggggttattctcaaagtcattacaaccaacatt
tgcggaagcgaccagcatatggtcagaggccgcacaacggcgcctgatggcttggtgctc
gggcatgaaattactggagaagttattgatacggggcgggacgttgaatttatcaaaaaa
ggcgatatcgtatccgttccttttaatattgcctgcgggcgctgtgtgatgtgcaaaacg
cagaaaacgcacgtgtgcctgaatgtcaatcctgaccggccgggctcggcttacggctac
gtcgatatgggcggctgggtcggcggccagtctgaatacgtcatggtgccctacgctgat
tttcagcttttggtattccctgataaagaacaggcgttagaaaagattctcgatttgacc
atgctgtccgacattttcccgaccggcttccacggagcttacacagcgggcgtgcaaaca
ggttcaaccgtttatatcgcgggagcggggcctgtcggcttggctgctgcacactccgct
cagctcctaggggcctccaccgtgattgtcggcgatctgaacgaagatagactggcacag
gcgagaagcttcggctgtgaaacggtcaacgtgcaaaaacacgaccgccttggcgagcaa
attgaacaaatactaggtgaaccaaccgttgatgccgcagtggactgtgtcggctttgaa
gcatccgggcacggcaatcaaggagaagcgccagccgccgtgctgaactcgatcatggat
gtcacccaggtcggaggcagcctcggaattccgggcttatacgtgaccgaagatcccggt
gcaaaggatgcagacgccaaaacaggctcattaaaaatccgcttcggactcggctgggcc
aaagcccacactttcgtcaccggacaaacgccggcaatgacatacaaccgcaatttgatg
aaagcgatcctgagcggcagagcgcagatcgcaaaagcggtcaacgccaccgtcatttct
ctggacgacgcgccaaaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtc
atcgacccgcatgggacattgaagtaa

DBGET integrated database retrieval system