KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_01630Help
Entry
BJ6T_01630        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K08738  cytochrome c
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bju00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJ6T_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAL05463
UniProt: G7DD76
Position
complement(149254..149667)
Genome map
AA seq 137 aa AA seqDB search
MNVRSNPVQQQSFASLVLTVSLVLTIVAIVFSTGLAHATGNVARGQTLYKGCADCHSINE
NAVGPMHKGVVGRKAGSVPGYDYSADLKNSGIVWTEDNLDKWLAGPQAMVPETKMFFDVP
DAQDRADIIAFLKEKAR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccggtccaatcccgtccaacagcaaagttttgcaagcctagtcctcaccgta
agcctggtcctcaccatcgtcgcgatcgttttctcgacggggcttgcccacgccaccggc
aacgtcgcgcgcggccaaacgctctacaagggctgcgcagattgtcactccatcaatgag
aacgctgtcggcccgatgcacaagggcgtggtcggtcgcaaggcgggcagcgtgcccggc
tatgactattcggccgatctgaagaactcagggatcgtctggaccgaggacaatctcgac
aaatggctggccggaccgcaggccatggtgccggaaaccaagatgtttttcgacgtcccg
gacgcccaggatcgtgctgatatcatcgcgtttctgaaggaaaaggcgcggtag

DBGET integrated database retrieval system