KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_02610Help
Entry
BJ6T_02610        CDS       T01848                                 

Definition
(GenBank) indoleacetamide hydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00330  Arginine and proline metabolism
bju00360  Phenylalanine metabolism
bju00380  Tryptophan metabolism
bju00627  Aminobenzoate degradation
bju00643  Styrene degradation
bju01100  Metabolic pathways
bju01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BJ6T_02610
   00360 Phenylalanine metabolism
    BJ6T_02610
   00380 Tryptophan metabolism
    BJ6T_02610
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BJ6T_02610
   00643 Styrene degradation
    BJ6T_02610
Enzymes [BR:bju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BJ6T_02610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAL05561
UniProt: G7DDH4
Position
complement(254489..256063)
Genome map
AA seq 524 aa AA seqDB search
MAKKTATKKKSVARKVTKTSVKTSTARKGAVTKAAKKTVKKPAPRKSATARRPKGPVWQW
SAVDTAAAIRNGAISAVETVEAHLERMRAVNPRLNAVVVDLSEEALKAAHAADKQRAKGV
ALGLLHGVPITIKENVDYEGRPNFNGVPANKDFVAPSDSPVVRNLKKAGAIVIGLTNTPE
FSFRGFTDNPLHGLTLNPWDPNITCGGSSGGAGSAVAAGIGTIAHGNDIGGSLRWPAHCN
GVATIKPTQGRIPAFNGSATAERPMLAHLMSAQGPLARHVGDVRLALDVMSQRDPRDPWW
VPAPLAGPKPKGPIKVALARIPEDMDVDPSVRAALRQAADHLERSGYRVTEVDVPDIDGV
WQTWCDIITNETVVMQEAGMLKVTSEDFHKAWGGMKTKANALDLKAWMQATAARNGHIRA
WQLFFEEYPVVLAPTTVKPTPGPRDDTVSADRVKEIFWGEIRFISAINVLGLPGAVVPVT
LHDGRPIGVQLIAGRYREDLALDAAAAIEKRAGVLAHRLWETME
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagaagacggcgacgaagaagaaaagtgttgcaaggaaagtaacgaagacctcg
gtcaagacgagcaccgcccggaagggggcagttacgaaggcggccaagaagacggtcaag
aagccggcgccgcgcaagtcggcgacggcgcgccgtccgaaaggtccggtctggcaatgg
tccgcggtcgacaccgcagccgcgatccgcaacggcgcgatctccgcggtcgagaccgtc
gaagcgcatctcgaacggatgcgcgccgtcaatccgcggctgaacgcggttgtcgtcgat
ctcagcgaggaagcgctgaaggctgcgcatgcggccgacaagcagcgcgccaagggcgtc
gcgctcggcctgctgcacggcgtgcccatcacgatcaaggagaatgtcgactacgaaggc
cggccgaatttcaacggtgtgcccgccaacaaggattttgtcgcgccgtcggactcgccc
gtggtgcgcaatctcaagaaagccggcgcgatcgtcatcggcctcaccaacacgccggaa
ttctccttccgcggcttcaccgacaatccgctgcacgggctgacgctgaacccctgggac
ccaaacatcacctgcggcggctcttcggggggcgccggctcggcggttgcggccggcatc
ggcaccatcgcccatggcaatgatatcggcggctcgctgcgctggccggcgcattgcaac
ggcgttgccaccatcaagccaacgcagggccgcatccccgccttcaacggaagcgccacc
gccgagcggccgatgctggcgcatctgatgtcggcgcagggcccgctcgcgcgtcacgtc
ggcgacgtccgcctcgcgctcgatgtgatgagccagcgcgatccgcgcgatccctggtgg
gtgccggcgccgctggccgggcccaagccgaaggggccgatcaaggtcgcactggccagg
attccggaggatatggacgtcgatccgtccgtccgcgcggcgctgcgtcaggccgccgat
cacctggagcgttccggctatcgcgtgaccgaggtcgatgtccccgacatcgacggcgtc
tggcagacctggtgcgacatcatcaccaacgagaccgtggtgatgcaggaggccggcatg
ctgaaggtgacgtccgaggacttccacaaggcctggggcggcatgaagaccaaggccaac
gcgctcgatctcaaggcctggatgcaggcgacggccgcacgcaacggccatatccgcgcc
tggcaattgttcttcgaggagtatcctgtcgtgctggcgccgaccacggtgaaaccgacg
ccgggaccgcgcgacgacaccgtcagcgccgatcgtgtgaaggaaatcttctggggcgag
atccgcttcatctccgccatcaacgtgctgggcctgcccggcgcggtggtgccggtgacc
ctgcatgacggccggccgatcggcgtgcagctcatcgcgggacgctatcgcgaggacctc
gcgctcgatgcggcggccgcgatcgagaagcgtgccggtgtgctcgcccaccggctctgg
gagacgatggagtaa

DBGET integrated database retrieval system