KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_02690Help
Entry
BJ6T_02690        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00970  Aminoacyl-tRNA biosynthesis
bju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJ6T_02690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bju03029]
    BJ6T_02690
Enzymes [BR:bju01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BJ6T_02690
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BJ6T_02690
Mitochondrial biogenesis [BR:bju03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BJ6T_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF4350
Motif
Other DBs
NCBI-ProteinID: BAL05569
UniProt: G7DDI2
Position
complement(263873..265261)
Genome map
AA seq 462 aa AA seqDB search
MDATRISQLIARRELSPVEVMRAHLDRIAAVNPKLNAIVTLADGAMEGAERAEAAVRSGA
QLGPLHGVPFTVKDGIDTAGVLTQRGSPIFRGRVPETDATVVARLKAAGAILIAKTNPPE
FSYSIETDNLLTGQTNNPWNLDYTPGGSSGGESAAIAAGMSPLGVGSDLSISLRGPAAHT
GIVGFKATHGRMPMTGHWPRVPRRFWHIGPMARSVRDVALAYSLMAGPDGADGFSISSPG
LDTGVGTKSTRQLRVGWMASPGFFGPIDPEVVATVKAAAQALSSAGYHVEQVRLPVVEQT
DANSVLWQLQQMESQPEFEKVTAGHEVEIFRHARLVLDAPDTPIADFVAAEQAIERLRDS
FAEYFRRYDVLLCPVTPFPATRHGLNDVVVDGVTVSPFHVMSATSPFSLTGMPALSMRFG
TSRDGLPIGVQVVSSWLAESTVLKVASLLEEVSPVRDLHPTI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggatgccacccgtatctcccagctcattgctcgacgggagctttcgcccgtcgaggtc
atgcgggcgcatctcgaccgcatcgcggcggtcaatcccaagctgaacgcgatcgtgacg
ctggctgatggcgccatggaaggcgcagagagggccgaggccgcagtcaggtcgggcgct
cagctcggcccgctccatggcgttccctttacggtcaaggatgggatcgacacggcgggc
gtgctgacgcagcgtggttcgcccattttcagagggcgtgtgcctgaaactgacgccacc
gttgtggctaggctgaaagccgccggcgctatcctgattgcaaagacgaaccctcccgaa
ttctcctattcgatcgaaacggataatctcctgacgggccagaccaacaacccctggaac
ctcgactacacgccgggcggatcgagcggcggtgaatccgccgccatcgcggcgggcatg
tcgccactcggtgtgggcagcgatctctcgatctcattgcgcgggccggcggcgcatacc
ggtatcgttggcttcaaagccactcacgggcgaatgccgatgacaggtcattggccccgg
gtgccacgtcgcttctggcacatcggtccgatggcacggtcggttcgcgacgtagcgctg
gcttattccttgatggcaggccccgacggtgccgacggcttctcgatcagctcgcccggc
ctcgatacaggcgttggcacgaaatcgacccgtcagcttcgcgtgggctggatggcctct
ccgggcttcttcgggcccatcgatccggaagtggtcgcgacggtgaaggcagcggcgcag
gcgttgagcagtgctggctaccacgtcgaacaggtccggttgccagtggtggagcagacc
gatgccaacagtgtcctctggcagcttcaacagatggaaagccaacccgagttcgagaag
gtcactgccggccacgaggtcgagatcttcaggcacgccagactggttcttgatgcacca
gatacgccgatcgccgacttcgtcgccgccgagcaggccatagagcgccttcgcgacagc
ttcgccgaatacttcaggcgctacgatgtgctgctctgcccggtaaccccgttccccgcg
accaggcatggtctcaacgacgtcgtggtcgatggcgtcacggtttcgccgttccacgtg
atgagcgcgacatcaccgttcagcctgacgggaatgcccgctctctcgatgcgattcgga
acgagccgcgacggtcttccgatcggtgtgcaagtcgtctcgtcctggctggcggaatcg
acggtgctcaaggtcgcctcgctcctcgaggaggtgagcccggttcgcgaccttcatccg
actatctga

DBGET integrated database retrieval system