KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_04200Help
Entry
BJ6T_04200        CDS       T01848                                 

Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00020  Citrate cycle (TCA cycle)
bju00310  Lysine degradation
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
Module
bju_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bju_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJ6T_04200
  Amino acid metabolism
   00310 Lysine degradation
    BJ6T_04200
Enzymes [BR:bju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BJ6T_04200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BAL05718
UniProt: G7DFB4
Position
complement(440219..441463)
Genome map
AA seq 414 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKKAGDPVAVDEPLVELETDKVTIEVPAPSAGTLSEIVA
ADGATVAVGALLGQITDGAGAAKPAAAPAKPAAAAPAAVAAAPAPAPAAKAPPADAPLAP
SVRKLSAETGIDASTVPGSGKDGRVTKGDMLAAIERAASAPTPVNQPAAAVQVRAPSPAD
DAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTNVMALRAHYKDAFEKKHGSK
LGFMGFFTKAVVQALKDIPAVNAEIDGTDLIYKNYYHIGVAVGTDKGLVVPVVRDCDNKS
IADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHKI
QERPMVVAGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgtgtgccgacgctcggcgaatccgtcaccgaggccaccatcggccgc
tggttcaagaaggccggcgatcccgtcgccgtcgacgagcccttggtggagctcgagacc
gacaaggtcaccatcgaggtcccggcgccctccgccggcacgctgagcgagatcgtcgcg
gccgatggcgcaaccgttgcggtcggtgcgctgctcggccagatcactgacggtgccggt
gctgcgaagcccgccgctgctcccgcgaagcccgccgccgccgctccggccgccgtggct
gctgctcctgcgccggctccggccgcgaaggcgccgccggccgatgcgccgctcgccccg
tccgtccgcaagctctcggccgagaccggcatcgatgcctccaccgtcccgggctccggc
aaggatggccgcgtcaccaagggcgacatgctcgccgcgatcgagcgtgccgcctccgcg
ccgaccccggtcaaccagcccgccgccgccgtgcaggtgcgcgcgccgtcgccggccgat
gacgccgcccgcgaagagcgcgtcaagatgacccgcctgcgccagaccatcgcgcgccgc
ctcaaggacgtgcagaacaccgcggccatgctgacgacctttaacgaggtcgacatgacc
aacgtgatggcgctgcgtgcccactacaaggatgcgttcgagaagaagcacggctcgaag
ctcggcttcatgggcttcttcaccaaggccgtcgtgcaggcgctgaaggacatcccggcg
gtcaacgccgagatcgacggcaccgatctgatctacaagaattactaccacatcggcgtc
gccgtcggcaccgacaagggtctcgtcgtgcccgtggtgcgcgactgcgacaacaagtcg
atcgccgacatcgagaagggcatcgccgatttcggtcgccgcgcccgtgacggccagctc
aagatcgacgagatgcagggcggcaccttcaccatcaccaatggcggcatctacggctcg
ctgatgtcgaccccgatcctgaacgccccgcagtccggcatcctcggcatgcacaagatc
caggagcggccgatggtcgtcgccggcaagatcgaggtccgtccgatgatgtacctggcc
ctgtcctacgatcaccgcgtcatcgacggcaaggaagccgtcaccttcctggtccgcgtc
aaggagagcctggaagatccggcgcgcctggtgctcgatctctga

DBGET integrated database retrieval system