KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_04240Help
Entry
BJ6T_04240        CDS       T01848                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00020  Citrate cycle (TCA cycle)
bju00640  Propanoate metabolism
bju00660  C5-Branched dibasic acid metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
Module
bju_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bju_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJ6T_04240
   00640 Propanoate metabolism
    BJ6T_04240
   00660 C5-Branched dibasic acid metabolism
    BJ6T_04240
Enzymes [BR:bju01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BJ6T_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAL05722
UniProt: G7DFB8
Position
complement(446150..447346)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLNEFGVAISKGVPVLKPADAEAAAKALPGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRIAKSAAEVAEFAKQMLGATLVTVQTGPAGKQVNRLYIEDGSDIDKEFYL
SILVDRETSRVSFVVSTEGGVNIEDVAHNTPEKIVTFSVDPATGIMGHHGRTVANALKLS
GDLAKQAEKLTAQLYTAFVAKDMSMLEINPLVVTKQGQLRVLDAKVSFDDNALFRHPEVL
ALRDETEEDAKEIEASKYDLNYVTLDGNIGCMVNGAGLAMATMDIIKLYGMSPANFLDVG
GSASKEKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAEGVTAAVREVGLSVPLVVRLE
GTNVELGKKIIRESGLNVVPADNLDDAAQKIVKAVKGG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcaagccaaagcgctgctgaacgagttcggcgtcgcgatctcg
aagggcgtccccgtcctgaagcccgcggacgcggaagccgccgccaaggccctcccgggt
ccggtctgggtggtgaagagccagatccacgccggtggccgcggcaagggcaagttcaag
gaagcctcggccggcgacaagggcggcgtccgcatcgccaaatcggccgccgaggtcgcc
gaattcgccaagcagatgcttggcgccacgctcgtgaccgtgcagaccggccccgccggc
aagcaggtcaaccgcctctacatcgaggacggctcggacatcgacaaggagttctacctc
tcgatcctggtcgaccgcgagacctcgcgcgtgtcgttcgtggtgtcgaccgaaggcggc
gtcaacatcgaggacgtcgcgcacaacacccccgagaagatcgtcaccttctcggtcgat
cccgcgaccggcatcatgggccatcacggccgcaccgtcgccaacgcgctgaaactctcc
ggcgatctcgccaagcaggccgagaagctcaccgcgcagctctacaccgccttcgtcgcc
aaggacatgtcgatgctggagatcaacccgctggtcgtgaccaagcagggccagctccgc
gtgctcgacgccaaggtgtcgttcgacgacaacgcgctgttccgtcaccccgaggtgctc
gcgctgcgcgacgagaccgaggaagacgccaaggaaatcgaggcgtcgaaatacgacctc
aactacgtcaccctcgacggcaatatcggctgcatggtcaacggcgccggtctcgcgatg
gcgacgatggacatcatcaagctctacggcatgtcgccggcgaacttcctcgacgtcggc
ggcagcgccagcaaggagaaggtcgcggccgcgttcaagatcatcaccgccgatcccaac
gtgaagggcatcctggtcaacatcttcggtggcatcatgaagtgcgacgtgatcgccgaa
ggcgtcacggccgccgtgcgcgaggtcggcctcagcgtgccgctggtggtccgcctcgaa
ggcaccaatgtcgagctcggcaagaagatcatccgcgaatccggcctgaacgtggtgccg
gccgacaatctcgacgacgccgcgcagaagatcgtgaaggccgtcaagggaggctga

DBGET integrated database retrieval system