KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_11890Help
Entry
BJ6T_11890        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00030  Pentose phosphate pathway
bju00051  Fructose and mannose metabolism
bju00052  Galactose metabolism
bju00230  Purine metabolism
bju00500  Starch and sucrose metabolism
bju00520  Amino sugar and nucleotide sugar metabolism
bju00521  Streptomycin biosynthesis
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_11890
   00030 Pentose phosphate pathway
    BJ6T_11890
   00051 Fructose and mannose metabolism
    BJ6T_11890
   00052 Galactose metabolism
    BJ6T_11890
   00500 Starch and sucrose metabolism
    BJ6T_11890
   00520 Amino sugar and nucleotide sugar metabolism
    BJ6T_11890
  Nucleotide metabolism
   00230 Purine metabolism
    BJ6T_11890
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BJ6T_11890
Enzymes [BR:bju01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BJ6T_11890
    5.4.2.8  phosphomannomutase
     BJ6T_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAL06480
UniProt: G7DPC8
Position
1271842..1273341
Genome map
AA seq 499 aa AA seqDB search
MFPKPKSVLLPNTYAFESEPMVKATGFREYDARWLFQKEINLMGIQALGMGLGALIAELG
VRQEIVTGHDFRGYSASIKYALISGLMAAGCKVHDIGLAVTPMAYFAQFDLDVPCCAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLNAEFKNKAGGSYQFHENYPARYIADL
TGRPKLTRKLKVVAACGNGTAGAFAPQVLEAIGCEVIPLDTELDHTFPKYNPNPEDMEML
HAIRDAVLHHKADVGLGFDGDGDRCGVVDNTGEEIFADKVGVMLARDMSAIHKDAHFIVD
VKSTGLFVTDPVLQKQGAKVAYWKTGHSYMKRRTHETGALAGFEKSGHFFFNKPYGRGYD
DGLVSAIAICDMLDRAPGKSMADLKNALPKTWSSPTMSPHCADETKYGVIDQVVKHFEGL
QAKGAKIGGQAIRDLVTVNGVRVTVEDGSWGLVRASSNKPELVVVVESPVSERRMHDMFE
MVNSVLRTHPEVGAYNQTI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaagccgaaatccgtcttgttgcccaacacctatgccttcgaatcagagccg
atggtgaaggccacgggttttcgcgaatacgacgcgcgctggttgttccagaaggaaatc
aacctgatggggatccaggcgctcggcatggggctgggcgcgctgattgcggagctcggc
gtcaggcaggagatcgtcaccggccatgatttccgcggctattcggcctcgatcaaatat
gcgctgatttccggcctgatggctgcgggctgcaaggtgcacgacatcgggctcgcggtg
acgccgatggcctatttcgcgcagttcgacctcgacgtgccctgctgcgcgatggtcacg
gcctcgcacaacgacaatggctggaccggcgtgaagatgggcgccaaccgcccgctgacc
ttcggccccgacgagatgacgcggctgaaggagatcgtgctcaacgccgaattcaagaac
aaggccggcggctcctaccagttccacgagaattatccggcgcgctacatcgccgatctc
accggccgtccgaagctgacccgcaagctcaaggtcgtcgccgcctgcggcaacggcacg
gccggcgcgttcgcgccgcaggtgctggaggcgatcggctgcgaggtgatcccgctcgac
accgagctcgaccacaccttcccgaaatacaatccgaacccggaagacatggaaatgctg
cacgcgatccgcgacgcggtgctgcatcacaaggctgatgtcggtctcggcttcgacggt
gacggcgatcgctgcggtgtcgtcgacaacaccggcgaggaaatcttcgccgacaaggtc
ggcgtgatgctcgcccgcgacatgtcggcgatccacaaggacgcgcatttcatcgtcgac
gtgaagtcgaccggcctgttcgtcaccgatcccgtgctgcagaagcagggcgccaaggtc
gcctattggaagaccggccattcctacatgaagcgccgcacccacgagacgggtgcgctc
gcgggcttcgagaagtctggccacttcttcttcaacaagccgtatggacgcggctatgac
gacggcctggtgtcggcgatcgcgatctgcgacatgctcgaccgcgcgccgggcaagtcg
atggccgacctgaagaacgcgctgccgaaaacctggtcgtcgccgaccatgtcgccgcat
tgcgccgacgagaccaagtacggcgtcatcgaccaggtggtgaagcattttgaaggcttg
caggccaagggcgccaagatcggcggccaggcgatccgcgatctcgtcaccgtcaacggc
gtacgcgtcacggtcgaggacggcagctggggcctggtgcgcgcgtcctccaacaagccc
gagctcgtcgtcgtggtcgagagcccggtctccgagcggcgcatgcacgacatgttcgag
atggtgaacagcgtgctccgtacgcatcccgaagtcggcgcgtacaatcagacgatttga

DBGET integrated database retrieval system