KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_12840Help
Entry
BJ6T_12840        CDS       T01848                                 

Definition
(GenBank) phosphonate metabolism protein
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00440  Phosphonate and phosphinate metabolism
bju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BJ6T_12840
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BJ6T_12840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnG
Motif
Other DBs
NCBI-ProteinID: BAL06574
UniProt: G7DPM2
Position
1372709..1373173
Genome map
AA seq 154 aa AA seqDB search
MDLVTQHNNQQVQRKAAMAVLAHAEAGEIAARLRALALPAHQELRAPENGLVMLRGRVGG
DGAPFNLGEATVSRAAVRLASGEVGFGYTLGRDGEKARLIALCDALAQSSDFGEAVERDV
IAPLREQLMIQRKQAAAETAATKVDFYTMVRGEG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggatttggtgacccagcacaacaaccagcaagtccagcgcaaggccgcgatggccgtg
ctggcgcacgcggaggcgggcgagatcgccgctcgcctccgcgctctcgccctgccggct
catcaggagctgcgcgcgccggaaaacggtctcgtcatgctgcgcggccgggtcggcggc
gacggcgcgccattcaatctcggtgaagccacggtgtcgcgcgcggcggtccggctcgcg
agcggcgaagtcggcttcggctacacgctggggcgcgacggcgagaaggcgcggctgatc
gcgctgtgcgacgcgctggcgcagtccagtgatttcggcgaggcggtggagcgtgacgtt
atcgcgccgttgcgcgagcagcttatgatccagcgcaagcaggcggcggccgagaccgcc
gcgacgaaggttgatttctacaccatggtgcgcggtgaggggtga

DBGET integrated database retrieval system