KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_13280Help
Entry
BJ6T_13280        CDS       T01848                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00340  Histidine metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BJ6T_13280
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BJ6T_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: BAL06617
UniProt: G7DQN9
Position
1406565..1407860
Genome map
AA seq 431 aa AA seqDB search
MPVRLDRSSADFDQRFAAFLAAKREVSADVEAAVRVIVDDVAKRGDAALLEATAKFDRLK
LDASGLRVSAAEIETAVKACDAATLDALKLARDRIETYHRRQLPKDERFTDPLGVELGWR
YTAIESAGLYVPGGTAAYPSSVLMNAVPAKVAGVARLVMVVPSPDGKLNPLVLAAASLGG
VSEIYRVGGAQAVAALAHGTATIAPVAKIVGPGNAYVAAAKRLVFGKVGIDMIAGPSEVL
VIADDTGNADWIAADLLAQAEHDASAQSILITDSARLATDVEKAVEAQLKTLPRTAIAGA
SWADFGAIIMVKNLADAIPLADAIAAEHLEIMTDDPDALAAKIRNAGAVFLGAHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVADFMKRTSILKCGPDQLRALGPAAMTLGQAEGLDAH
SRSIGLRLNLS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcgtctcgaccgcagcagcgccgattttgaccagcgattcgcggccttcctc
gccgccaagcgcgaggtctcggccgacgtcgaggccgccgtgcgcgtcatcgtcgacgat
gtggcgaagcgtggcgatgcggccctgctcgaggccacggcaaagttcgaccggctgaag
ctggatgcatccggcctgcgcgtctccgccgccgagatcgagacggccgtgaaggcctgc
gatgccgcgacgctggatgcgctcaagctcgcgcgcgaccgcatcgagacctatcaccgc
cgccagctcccgaaggacgagcgcttcaccgatccgctcggcgtcgagctcggctggcgc
tataccgcgatcgaatccgcgggcctctacgtgcccggcggcaccgcggcctatccctcc
tcggtgctgatgaacgcggtgcccgcgaaggtcgccggcgtcgcgcgcctcgtcatggtg
gtgccgtcgccggacggcaagctcaatccgctggtgctggcggccgcttcgcttggcggt
gtcagcgagatctaccgggtcggcggcgcgcaggcggtggcggcgctcgcccacggtacc
gccacgatcgcgccggtggccaagatcgtcggccccggcaatgcgtatgtcgccgccgca
aaacggctggtgttcggcaaggtcggcatcgacatgatcgcgggcccctccgaggtgctg
gtgatcgccgacgacaccggcaatgccgactggatcgccgctgatctgctggcgcaggcc
gaacacgacgccagcgcgcaatcgatcctgatcacggattccgcgcgcctcgccaccgat
gtcgagaaggccgtcgaagcgcagctgaagacattgccgcgcacagcaattgccggcgcc
tcctgggccgatttcggcgccatcatcatggtgaagaatcttgccgacgccattccgctc
gcggatgcgatcgcggccgagcatctcgagatcatgactgatgatcccgacgcgcttgcc
gcaaagatccgcaatgctggcgcggtgttcctcggcgcgcatacgcccgaggcgatcggc
gactatgtcggcggctccaaccacgtgctgccgacggcgcgctcggcgcggttctcctca
ggccttggagttgccgacttcatgaagcgcacctcgatcctgaaatgcggtccggaccag
ctgcgtgcgctcggacctgccgcgatgacgctcggacaagcggaggggctggacgctcat
tcgcgctcgattggattgcgcctcaatctgtcatga

DBGET integrated database retrieval system