KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_18180Help
Entry
BJ6T_18180        CDS       T01848                                 

Definition
(GenBank) molybdopterin converting factor, large subunit
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00790  Folate biosynthesis
bju01100  Metabolic pathways
bju04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BJ6T_18180
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BJ6T_18180
Enzymes [BR:bju01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     BJ6T_18180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE SART-1
Motif
Other DBs
NCBI-ProteinID: BAL07099
UniProt: G7D4L0
Position
complement(1898839..1899321)
Genome map
AA seq 160 aa AA seqDB search
MSAPVSPCPVTIRIQQDDFDIAREIAILTGSRTDIGAVVSFSGICRGDEDSAKIAALTLE
HYPGMAEEEIKRHADEATSRWPLNGVTIIHRVGRFMPGQNIVLVLAASQHRQAAFQAAEF
LMDYLKTSAPFWKKEESATGTGWVEAHARDDEAAARWTRS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccccgtcagcccctgccccgtcaccatccgcatccagcaggacgatttcgac
atcgcgcgcgagatcgcgatcctgaccgggagccgcaccgacatcggcgcggtcgtgagc
ttttccggcatctgccgcggcgacgaggacagcgcgaagatcgccgccctcacgctcgaa
cattatcccggcatggcggaagaagagatcaagcgccatgccgacgaagccacatcgcgc
tggccgctgaacggcgtcaccatcattcatcgcgtcgggcggttcatgcccggccagaac
atcgtgctggtgctcgcggcgtcgcagcaccgccaggcagcgttccaggcagccgagttc
ctgatggactatctcaagaccagcgcgccgttctggaagaaggaagagagcgccaccggc
accggctgggtcgaagcccacgcccgtgacgacgaggccgccgcacgctggacccgatcc
tga

DBGET integrated database retrieval system