KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_22760Help
Entry
BJ6T_22760        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BJ6T_22760
Enzymes [BR:bju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BJ6T_22760
Transporters [BR:bju02000]
 Other Transporters
  Pores ion channels [TC:1]
   BJ6T_22760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAL07555
UniProt: G7D8M8
Position
complement(2348046..2348687)
Genome map
AA seq 213 aa AA seqDB search
MILYYHPGGCSLADHIVLIETGLPYRLVKVERGKRTEDGRDFMTINPKGFIPALELDDGS
VLTENLAILVYIAHQAGALLPSDGLDRWRALEATSFMTTEFHGNFRPFSHVDATHAERDK
ARKLLVKHFATIAGQLGDRPFLVGDRMTIADPYLVVMLMWAEKNEIEVPKRLNDYLAHMK
TIPSVAKALTDEGLVRGPAVSKSARRFGAEPLG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcctctattaccatcccggcggctgtagcttggctgatcacatcgtgctgatcgag
acaggccttccatacagactcgttaaagtcgaacggggcaagcggaccgaggatgggcgt
gacttcatgacgatcaatccaaagggtttcattcccgcgctggaactcgacgacgggagt
gtccttaccgaaaatctcgccattcttgtctatatcgcccaccaagcaggggccctgctt
cccagcgacggtctcgaccgttggcgcgcgcttgaagccacttccttcatgaccaccgaa
ttccatggcaatttcaggccgttttcccacgttgacgcgacccacgcggaaagggacaag
gcacgaaagttgctggtcaagcatttcgctacgatcgccggccagcttggcgataggccg
tttctggtgggcgatcgaatgacgatcgcagatccatatcttgtcgtgatgctgatgtgg
gctgagaagaacgagatcgaggtgccgaagcggctcaacgactatctcgcgcacatgaag
acgattccttcggtcgccaaggcgctcaccgatgaagggctcgtccgaggcccggcggta
tccaaatctgcgcggcggttcggagccgaaccgctgggctga

DBGET integrated database retrieval system