KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26600Help
Entry
BJ6T_26600        CDS       T01848                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00030  Pentose phosphate pathway
bju00480  Glutathione metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
Module
bju_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BJ6T_26600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJ6T_26600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bju04147]
    BJ6T_26600
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BJ6T_26600
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BJ6T_26600
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BJ6T_26600
  Exosomal proteins of colorectal cancer cells
   BJ6T_26600
  Exosomal proteins of bladder cancer cells
   BJ6T_26600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAL07938
Position
complement(2740629..2742140)
Genome map
AA seq 503 aa AA seqDB search
MTKDPQAKRKPENCAFVIFGATGDLTHRLVLPSLYNLAAEHLLPEKFCVVGVARNRQSDD
ELRDSLLKGLRQFATRPVDDDIARKLLECVTFVEADPKDPPSFDRLREHLDSLECAQDTG
GNRLFYLATPPAAFAPTARELGRTGMMKENGAWRRLVIEKPFGTDLASAKALNAELLKIM
DEHQIYRIDHYLGKETVQNIMVLRFANGMFEPIWNRNHIDHIQITVEEKLGVGHRGGFYD
ATGALRDMVPNHLFQLMSLVAMEPPARFDAHSVRSEKADVLTSIQQPSREEALKNSVRAQ
YLAGRIGDDEITDYRKTEDVKPGSTTETFVALKLMIDNWRWAGVPFYLRTGKALGHKRTE
VAIKFKQAPLSMFSGTTVDRLSQNFLTIGIAPTETIELQFNAKIPGPSVTIDGVEMKFRY
GDYFRADPSTGYETLIYDCMIGDNILFQRADGIEAGWQAVQPFLDAWKSEGTNGIETYDA
GSDGPACADELLRRDGRSWRKYS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaagacccgcaggccaagcgcaagcccgaaaattgcgccttcgtcatctttggc
gcgaccggtgacctcacccatcggctggtgctgccgtcgctctacaatctcgccgccgag
cacctgttaccggagaagttctgcgtcgtcggcgtggcccgcaaccgccagtccgatgac
gagctgcgcgacagcctgctgaagggtctgcggcaattcgcgacgcggcccgtggacgac
gacattgcccggaagctgctggaatgcgtgaccttcgtcgaggccgatccgaaggatcca
ccgtccttcgaccgcctgcgcgagcatctggattcgctggaatgcgcgcaggacaccggc
ggcaaccgcctgttctatctggcaacgccgcccgccgccttcgcgccgaccgcgcgcgag
ctcggccgcaccggcatgatgaaggagaacggcgcctggcggcggctcgtgatcgagaag
ccgttcggcaccgacctcgcctcggccaaggcgctgaatgccgagctgctgaagatcatg
gacgagcaccagatctaccggatcgatcactatctcggcaaggagacggtgcagaacatc
atggtgctgcgcttcgccaacggcatgttcgagccgatctggaatcgcaaccacatcgac
cacatccagatcacggtggaggagaagctcggcgtcggccatcgcggcggcttctacgac
gccaccggcgcgctgcgtgacatggtgccgaaccatctgttccagctgatgtcgctggtt
gcgatggagccgccggcgcgcttcgacgcgcattccgtgcgctccgagaaggccgacgtg
ctgacgtcgatccagcagccgagccgcgaggaagcgctgaagaactccgtgcgggcgcaa
tatctggcaggccgcatcggcgacgacgagatcaccgactatcgcaagaccgaggatgtc
aagcccggcagcaccaccgagacctttgtcgcgctcaaactgatgatcgacaattggcgc
tgggccggcgtaccgttctatctgcgcaccggcaaggcgctcggccacaagcgaaccgaa
gtcgcgatcaagttcaagcaggcgccgctgtcgatgttctcaggcacgacggtcgaccgc
ctgtcgcagaacttcctcaccatcggcatcgcaccgaccgagaccatcgagcttcagttc
aatgccaagattccggggccgagcgtcaccatcgacggcgtcgagatgaaattccgctac
ggcgactatttccgcgccgacccctcgaccggctatgagacgctgatctacgactgcatg
atcggcgacaacatcctgttccagcgcgccgacggcatcgaggccggatggcaggcggtg
cagccgttcctggacgcctggaaaagtgaaggcaccaacggcatcgagacctatgacgcc
ggcagcgacggcccggcctgcgccgatgaactactccggcgcgacgggcgcagctggcgg
aagtattcgtga

DBGET integrated database retrieval system