KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_27940Help
Entry
BJ6T_27940        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00564  Glycerophospholipid metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
Module
bju_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJ6T_27940
Enzymes [BR:bju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BJ6T_27940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: BAL08072
Position
2876105..2876968
Genome map
AA seq 287 aa AA seqDB search
MTVKALIASFTQQEDLNFLLTNRIPRAALTRFMGWFSKIENPLVRDFSIALWKLFSDLDL
SEARKTHFKSLHDCFTRELKPGLRPFDPAPSIVASPSDGIVGAHGRIADTELFQVKGAPY
SLLDLLGDSALVDQHRNGSFVTLRLTSSMYHRFHAPYDAHIERVTLIHGDVWNVNPIALK
RVERLFCKNERAVIRTHLSTGEAVTLVPVAAILVASIRLHFLDMVLNAQTRGPVNFPCDV
NVTKGEELGWFEHGSTIIILAPGDFNFCDGIGEGTRIRAGQPLLKKN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaaagccctcatcgcctctttcacccagcaggaagacctcaacttcctgttg
accaaccgcatcccccgcgcggccctgacccgcttcatgggctggttctccaagatcgag
aacccgctcgtcagggacttctcgatcgcactgtggaagctgttctccgacctcgatctg
tcggaggcgcgcaagacccacttcaagagcctgcacgactgtttcacccgggagctcaag
ccggggttgcggcccttcgatcccgccccttccattgtcgccagcccctcggacggcatc
gtcggcgcccatggccggatcgccgacaccgaactgttccaggtcaagggcgcgccctat
tcgctgctcgacctgctcggcgactccgctctcgtggatcagcaccgcaacggctccttc
gtcacgctgcggctgacatcgagcatgtatcaccgcttccatgcgccatatgatgcgcat
atcgaacgcgtcacgctgatccatggcgacgtctggaacgtcaacccgatcgcgctgaag
cgggtcgagcgtctgttctgcaagaacgagcgcgcggtgatccgcacgcatttgtcgacc
ggcgaggccgtgacgctggtgccggtcgccgcgatcctggtcgcgagcatccgcctgcac
ttcctcgacatggtgctgaacgcgcagacccgcggcccggtcaatttcccctgcgacgtc
aacgtgaccaagggcgaggagctcggctggttcgagcacggctccaccatcatcatcctg
gcgcccggcgatttcaacttctgcgacgggatcggcgagggcacccgcattcgtgcaggt
caaccgctgttgaagaaaaactag

DBGET integrated database retrieval system