KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_33570Help
Entry
BJ6T_33570        CDS       T01848                                 

Definition
(GenBank) ATP-dependent Clp protease, ATP-binding subunit
  KO
K11907  type VI secretion system protein VasG
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bju00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BJ6T_33570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bju02044]
    BJ6T_33570
Secretion system [BR:bju02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   BJ6T_33570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_22 TniB AAA_7 NACHT Zeta_toxin ATPase_2 AAA_18 AAA_14 TsaE AAA_24 AAA_30 Hpr_kinase_C SRP54 AAA_6
Motif
Other DBs
NCBI-ProteinID: BAL08631
UniProt: G7DJI2
Position
complement(3431123..3433762)
Genome map
AA seq 879 aa AA seqDB search
MTDISIEAVTGKLNRAGYDAFIQALRHAKSAGNRNVELAHWLFHILQQERNDLSLSVDHY
KLDRARLLSDLAGVINGFRKNETDMPGVANPVIDLLDRGWHYATLFFGETQIRTGHLLVA
GLKSNDIRRTLNNLSQEFAKVNVDALAAERRNVWAGSDEETMRPMDGSGLVGAGTEGAAQ
AGPKGTTPLDRFSQDLTAKAKSGEMDPILGRDEEIRQLIDVLMRRRQNNPILTGEAGVGK
TAVVEGFAQRIAAGDVPPPLRGVRLCALDIGLMQAGASMKGEFEQRLRSVIDEVQSSPTP
IILFIDEAHTLIGAGGAAGTGDAANLLKPPLARGTLRTIAATTWAEYRQYIEKDPALTRR
FQPIQIDEPEVETCCVMLRGLLGPMEKHHGVRISDAAIVAAVNLSHRYIPSRQLPDKAVS
LLDTASARVAISQSATPALIEDARVAITAREAERSALVSDSDLGIEGDERIVVIDNDIAA
LKDKLTNLEADWAKEQALVKDIRSIREILSEPKEGDDPAARRAELRGKFDTLESINPEKR
MVYAHVDQQSVASVVSDWTGIPVGRMMRDEIETVLKLPEILNRRVVGQSHGLTMIAKRIE
TSRAKLDNPSKPIGVFMLAGPSGVGKTETALALAETLYGGEQNMITINMSEFQEAHTVST
LKGAPPGYVGYGEGGRLTEAVRRKPYSVILLDEVEKAHPDVHEIFFQVFDKGTMEDGNGR
RIDFKNTLIILTTNVGTDLIMGLARDPKYRSEPEELAKMLRPELLKVFPAALLGRIVSIP
YFPLSDEMLAGIVRLQLDRIGRRLRDNHNASFDYDDAVVEHIVSRCNDPDSGGRMIDNII
TNTLLPELSREFLSKSLAKEEIKKARVSIENDKFAYSWN
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcagcattgaggctgtaacgggcaagctgaaccgggccggctatgatgcc
ttcatacaggccctgcgtcacgcgaagagcgccggcaatcgcaacgtcgagctagcgcac
tggctgtttcatatcctgcagcaggaacgcaacgatctcagcctctcggtcgatcattac
aagctcgaccgggcacgcttgttgtcggaccttgccggcgtgatcaatggctttcgtaag
aacgaaaccgacatgccgggcgtcgccaatccggtcatcgatctgctcgatcggggctgg
cattatgccacgctgttctttggcgaaacccagatccgcaccggtcatctgcttgtggcg
ggcctgaaatcgaacgatattcgtcgcacgctgaacaacctctcgcaggaattcgccaag
gtcaacgtcgacgcactcgccgcggagcgccgcaacgtctgggccggctccgacgaggaa
accatgcggccgatggacggttcgggcctggtcggtgcaggcacggaaggcgcggcccaa
gcgggtcccaaggggacgacgccgctcgaccggttctctcaggatctcaccgccaaggcc
aaatcgggcgagatggatccgatccttggccgggacgaagaaatccgccagctgatcgac
gtgttgatgcgacggcggcagaacaatccaattcttaccggcgaggctggcgtcggcaag
accgcagttgtcgagggattcgcccagcgaatcgccgccggcgacgtgccgccaccgctc
cgcggtgtaaggctttgtgcgctcgatatcggcctgatgcaggccggtgcttccatgaag
ggtgagtttgagcagcgcttgcgctcggtgatcgacgaggtccagagctcacccaccccc
atcatactgttcatcgatgaagcccacacattgatcggcgccggcggcgcggccggcacc
ggtgatgcggccaatctcctgaaacctcctctcgcccgtggcacgctgcgcacgatcgcc
gccaccacatgggcagaatatcgccagtatatcgagaaagatcccgcgctcacacgacgc
ttccagccgatccagatcgatgagccggaagtggagacctgctgcgtcatgctgcgcgga
cttctcggtccgatggaaaagcaccacggggttcgcatctccgatgctgccatcgtcgca
gcggtcaacttgtcccaccgctacattccttcacggcagctgccggacaaggcggtcagc
ctgcttgacaccgcctcggcacgcgtggccatcagccagagcgcgacgccagccctgatc
gaggatgcacgcgttgcgattaccgctcgtgaagcggagagatcggcactcgtcagcgac
agtgatcttgggattgagggcgacgagcgcatcgtagtgatcgacaacgacattgcagca
ctgaaggacaagctgacgaacctcgaagccgattgggccaaagagcaggcgctcgtcaag
gacatccgcagcattcgagagatcctgtccgaacccaaggaaggcgacgatccggctgcc
aggcgcgcggagctgcgcggcaagttcgacacacttgagagcatcaatccggaaaagcgg
atggtctatgcccatgtagaccagcaatcggtggcgtccgttgtttctgattggaccggc
atcccggtcggccggatgatgcgcgacgagatcgaaaccgtgctgaaactaccggagatc
ctcaaccgccgcgtcgtcggccagtctcatgggctgacgatgatcgccaagcgaatcgag
accagccgcgccaaactggacaacccgtcgaagccgatcggcgtgttcatgctggctggt
ccatccggcgtgggcaaaaccgaaaccgcgctggcgcttgccgagaccctttacggcggc
gagcagaacatgatcacgatcaacatgtcggagttccaggaagcgcacaccgtctcgacc
ttgaagggtgcacctcccggctatgtcggctacggcgaaggtgggcgcctcacggaggct
gtccggcgcaagccctacagcgtcatcctgctcgacgaggtggagaaagctcatcccgac
gtccacgagatcttcttccaggtgttcgacaagggaaccatggaagacggcaacgggcgg
cggatcgacttcaagaacaccttgatcatccttaccaccaacgtcggcaccgatctgatc
atgggtctcgcgcgcgatccaaagtatcgcagcgagccggaagagctcgccaagatgctg
aggccggaattgctgaaggtgtttcctgcagcgctgctcggacgcatcgtctcgataccg
tacttcccgctatccgacgagatgctcgccgggatcgttcggttgcagctcgaccggatc
ggacgacgcctccgcgacaatcataacgcgtccttcgactacgatgacgcggtcgtggag
cacatagtgtcacgttgcaacgacccggattccggcgggcgaatgattgacaacatcatc
accaacaccctgctcccggagctgtcgcgcgagttccttagcaaatcgcttgccaaggaa
gaaatcaagaaggcgcgggtctcgatcgagaacgataagttcgcatattcgtggaattga

DBGET integrated database retrieval system