KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_33610Help
Entry
BJ6T_33610        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bju00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BJ6T_33610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bju02044]
    BJ6T_33610
Secretion system [BR:bju02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   BJ6T_33610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: BAL08635
UniProt: G7DJI6
Position
complement(3437586..3438071)
Genome map
AA seq 161 aa AA seqDB search
MAVDIFLKLDPIKGESLDDKHKDEIDILSWSFGESQTGTFHSGSGGGAGKVSVQDLHFTH
FVDKATPELFKVCANGKHIDSAILTVRKAGENPLEYLKIEMKQVLVTSVSTGGSHGEDRL
TENVSLNFAKVKMIYKTQTEKGGAGASPTFGWDVPANKEWA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgacatcttcctgaaactcgatccgatcaagggcgagtcgctggacgacaag
cataaagacgaaatcgatattttgagctggtcgtttggcgagagccagaccggcaccttc
cacagcggatcgggcggcggcgccggcaaggtcagcgtgcaggatcttcacttcacgcac
ttcgttgacaaggccacgccggagcttttcaaggtctgcgcaaacggaaagcatattgac
agcgcgatcctgacggtccgcaaggccggcgaaaacccgctggaatatctcaagatcgag
atgaagcaggttctcgtgactagcgtatcaacaggcggatcgcacggcgaagatcggctt
accgaaaacgtgagtctgaacttcgcaaaggtcaagatgatctacaagacccagacggag
aagggtggcgccggagcttcgccgacgtttggctgggatgttcctgccaacaaggaatgg
gcctga

DBGET integrated database retrieval system