KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_33690
Entry
BJ6T_33690        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bju00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BJ6T_33690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bju02044]
    BJ6T_33690
Secretion system [BR:bju02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJ6T_33690
SSDB
Motif
Pfam: DotU OmpA Roughex
Other DBs
NCBI-ProteinID: BAL08643
Position
3447148..3448674
AA seq 508 aa
MSDRDKPVNPFGRGERTIIRPNPGGKLPPAPTSQPPPGEGPAARPGYSPSPVPSPGAPAP
PSSFSPVPQGSNYASAPASHPAEEWISTPAQAQAQQPMLPPGPPLRVDDLVAPNANPVMR
AAGPLLQLLGRLRVALMRASFASLMEQVADAIKFFEKDIRSAGISEHQANTAKYILCATA
DDIVQHIPTEERHVWTQYSMLSRFFGERVGGVRFFEILDHLKVDPLVNYPVLELQHACLA
LGFQGIHRTSGGGLANLQLIQRNLYELLRRVRPKTMSDLSPNWRGQALAGRRQRLRVPVW
LVAAVVAALLTGSYFVLRTLLAGRSENAAEVALALHPAGPIELKRQIVAPPPPPPPPPPP
DRITQLQRIRNALAKENTACAMTADQTPSFIVIRVCDLALFASGQATILDGFKPIALRVA
ATLDKEPGRIRVVGHTDSSPIRTVRFPSNFELSVERAKAVAAALKPGLTDGARVDVEGKG
ADAPIASNTTPEGRAKNRRVEIFIERSE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgagcgacagggacaagccggtcaatcctttcggtcggggcgaacggacgatcattcgt
cccaaccccggcgggaagttgccgccggcgccgacctctcagcctccgccgggcgagggg
cccgcggcacgcccaggctattcgccatcaccagtaccctctcccggcgcgccggcgcca
ccgtcatcattttctcctgtcccgcagggctcgaactacgcctccgcgccggccagccat
cccgctgaggaatggatatcgacacccgcacaggcccaggcgcagcagcctatgctaccg
ccaggaccgccgctgcgcgtcgacgatctcgtcgcgccaaatgccaatccagtgatgcgt
gctgcgggcccgttgctgcagctgcttggtcggttgcgggtggcgctcatgcgcgcgtca
ttcgcgagtttgatggagcaggttgcagacgcgatcaagttcttcgagaaggacatccgt
tccgcgggcatatccgagcaccaggccaacacagcgaaatacatcctgtgtgccactgcc
gacgatatcgtgcagcacatcccaaccgaggagcgccacgtctggacgcaatattcgatg
ctgagccggttcttcggcgagcgtgtcggcggcgtccgtttcttcgagatcctcgaccat
ttgaaggttgatccactggtcaactatccggtcctcgaactccagcacgcctgccttgcg
cttggttttcagggcattcaccggacgtcaggtggcggacttgcgaacctgcagctgatc
cagcgtaacctttatgaattgctgcgccgggtccggccgaagacgatgagcgacctgtcg
cccaactggcgcgggcaggcgctggcggggcgccggcagcgtctgcgcgttccggtctgg
ctcgtcgcggccgtcgtcgccgcgctgctgaccgggtcctatttcgtcctgcggacgctc
ctcgctggccggtcagagaatgctgccgaggtggcgctcgcgctccatccagccggcccg
atcgagctcaagcgccagatcgttgcaccaccgccgccgcctccacctccgccgccaccg
gatcgcatcacccagttgcaacgcatccgcaatgcgctcgcgaaggagaacaccgcctgt
gccatgacggcggaccagaccccgagcttcatcgtgatcagggtctgcgatctggcgctg
ttcgcgtcgggccaggcgaccatcctcgacggtttcaagccgatcgcactccgcgtcgca
gcaaccctcgacaaggagccgggacggattcgggtcgtcggccataccgacagttcgccg
atccgcacagtccgcttcccgtcaaatttcgagttgtcggtcgagcgtgccaaggcggta
gccgcggcattgaagcctggcttgaccgatggcgcacgcgtcgacgtcgagggcaaagga
gcagatgcgccaatcgccagcaacacgacacccgagggacgcgccaagaaccggcgcgtc
gagatctttatcgaacgcagcgaatag

DBGET integrated database retrieval system