KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_34860Help
Entry
BJ6T_34860        CDS       T01848                                 

Definition
(GenBank) alcohol dehydrogenase class III
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00071  Fatty acid degradation
bju00350  Tyrosine metabolism
bju00625  Chloroalkane and chloroalkene degradation
bju00626  Naphthalene degradation
bju00680  Methane metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
bju01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_34860
  09102 Energy metabolism
   00680 Methane metabolism
    BJ6T_34860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_34860
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BJ6T_34860
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJ6T_34860
   00626 Naphthalene degradation
    BJ6T_34860
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BJ6T_34860
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     BJ6T_34860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAL08760
Position
complement(3583990..3585099)
Genome map
AA seq 369 aa AA seqDB search
MKTRAAVAFEAKKPLEIVEVDLEGPKAGEVLVEIKATGICHTDAYTLDGFDSEGIFPSIL
GHEGAGIIREIGPGVTSVKPGDHVIPLYTPECRQCKSCLSQKTNLCTAIRATQGKGVMPD
GTSRFSYKGKPVYHYMGCSTFSNFTVLPEIAVAKIREDAPFDKSCYIGCGVTTGVGAVVN
TAKVTPGSNVVVFGLGGIGLNVIQGAKMAGADKIIGVDINDSKEDWGRRFGMTEFVNPKK
ITGDIVAHLVNLTDGGADYTFDCTGNTTVMRQALEACHRGWGTSIIIGVAESGKEIATRP
FQLVTGRNWRGTAFGGARGRTDVPKIVDWYMNGKIQIDPMITHVLKLEEINKGFDLMHEG
KSIRSVVVF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacgtgccgccgttgctttcgaagccaagaaaccactcgagatcgtcgaagtc
gatctggaaggaccgaaggcaggcgaagtcctggtcgagatcaaggcgacgggcatctgc
cataccgacgcctacacgctcgacggcttcgacagcgaaggaatcttcccgtcgatcctg
ggtcatgagggcgccggtatcatccgcgagatcggaccgggcgtgacctcggtgaaaccg
ggcgaccacgtcatcccgctctacacgccggagtgccggcagtgcaaaagctgcctgagc
cagaagaccaatctctgcaccgcgatccgcgcgacgcagggcaagggcgtgatgcccgat
ggcaccagccgcttctcctacaagggcaagccggtctaccactacatgggctgctcgacc
ttctcgaacttcaccgtgctgccggagatcgccgtcgccaagatccgcgaggacgcgccc
ttcgacaagagctgctacatcggctgcggcgtcaccaccggcgtcggcgccgtcgtcaac
accgcgaaggtcacaccgggctccaacgtggtcgtgttcggcctcggcggcatcggcctc
aacgtgatccagggcgccaagatggccggcgccgacaagatcatcggcgtcgacatcaac
gactccaaggaggattggggccgccggttcggcatgaccgagttcgtcaaccccaagaag
atcaccggcgacatcgtcgcgcatctggtcaacctgaccgacggtggcgccgactacacc
ttcgattgcaccgggaacaccaccgtgatgcgccaggcgctggaagcctgccatcgcggc
tggggcacctcgatcatcatcggcgttgccgaatccggcaaggagatcgccacccgcccg
ttccagctcgtcaccgggcgcaactggcgcggcacggccttcggcggcgcacgcggccgc
accgacgtgcccaagatcgtcgactggtacatgaacggaaagatccagatcgatccgatg
atcacccacgtgctcaagctcgaggagatcaataagggctttgacctcatgcacgagggc
aaatccatccgttcagtcgtcgtgttctag

DBGET integrated database retrieval system