KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_40780Help
Entry
BJ6T_40780        CDS       T01848                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00071  Fatty acid degradation
bju00350  Tyrosine metabolism
bju00625  Chloroalkane and chloroalkene degradation
bju00626  Naphthalene degradation
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_40780
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_40780
  Amino acid metabolism
   00350 Tyrosine metabolism
    BJ6T_40780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJ6T_40780
   00626 Naphthalene degradation
    BJ6T_40780
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BJ6T_40780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAL09352
UniProt: G7D297
Position
4200901..4201926
Genome map
AA seq 341 aa AA seqDB search
MPTMKAAVVKQFGKPLVIEDVAVPQPGPGEVLVEVKACGVCHTDLHAASGDWPVKPTPPF
IPGHEAAGIVAALGPGVKNLKVGDAVGVAWLHDACMACEYCETGWETLCEHQHNTGYSVN
GGFAEYVIASAVFAAKLPPTVDFAAIAPILCAGVTTYKGLKETDARPGEWVAISGVGGLG
HVAIQYAKAMGFKVAAIDIAEDKLALARETGADLAVNALAADAVNEVLTATGGGAHGVLV
TAVSTAAFAQALEIVRRKGTVSLVGLPPGEFPTPIFDVVLKRITVRGSIVGTRRDLAEAV
AFATEGKVKAEVTKVPLAQINDVFERMKAGKIDGRMVLDFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccatgaaggccgcagtcgtcaagcaattcggcaagccgctggtgatcgaggac
gtggcggtgccgcagcccggtcccggcgaggttttggtcgaggtgaaagcgtgcggcgtc
tgccacaccgatctgcacgccgcttccggcgactggccggtgaagccgacgccgcctttc
attcccggccatgaagccgcaggtatcgtcgccgcgctcggccctggcgtgaaaaacctg
aaggttggcgatgctgtcggcgtcgcctggctgcatgacgcctgtatggcctgcgaatat
tgcgagaccggctgggagacgctgtgcgagcaccagcacaacaccggctacagcgtgaac
ggcggctttgcagaatatgtcatcgcctcggctgtctttgccgcaaagctgccgcccacc
gtcgatttcgcggcaatcgcgccgatcctgtgcgccggcgtcaccacctacaagggattg
aaggaaaccgacgcgcggcccggcgaatgggtggcgatctcaggcgtcggcgggctcggc
catgtcgcgatccaatacgccaaggcgatgggcttcaaggtcgcggcgatcgatatcgcc
gaggacaagcttgcgctcgcgcgcgagaccggcgccgatctcgcggtcaacgcgctcgcc
gctgatgccgtaaatgaggtccttacggcgaccggaggcggggcgcacggcgtactggtg
acggcggtctcgaccgcggcatttgcgcaggctctagagatagtgcgccggaagggcacg
gtcagcctcgtcggcctgccgccgggtgaattcccgacgccgatcttcgacgtcgtgctc
aagcgtatcaccgtgcgcggctccatcgtaggcacccgccgggatctcgccgaagctgtc
gcattcgccaccgagggcaaggtcaaggccgaggtgacgaaggtgccgctggcgcaaatc
aacgacgtcttcgagcggatgaaggccggcaagatcgatggccgcatggtgctggacttt
ggctag

DBGET integrated database retrieval system