KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49010Help
Entry
BJ6T_49010        CDS       T01848                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00051  Fructose and mannose metabolism
bju00562  Inositol phosphate metabolism
bju00710  Carbon fixation in photosynthetic organisms
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
bju01230  Biosynthesis of amino acids
Module
bju_M00002  Glycolysis, core module involving three-carbon compounds
bju_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_49010
   00051 Fructose and mannose metabolism
    BJ6T_49010
   00562 Inositol phosphate metabolism
    BJ6T_49010
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJ6T_49010
Enzymes [BR:bju01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BJ6T_49010
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BJ6T_49010
  Exosomal proteins of bladder cancer cells
   BJ6T_49010
  Exosomal proteins of melanoma cells
   BJ6T_49010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAL10163
UniProt: G7D972
Position
4980210..4980965
Genome map
AA seq 251 aa AA seqDB search
MTDANRPLIAGNWKMNGLKGSAAEFDAMLKGAAEVAAKADLLVCPPATLITAFADKARGS
KVAVGAQDCHPKASGAHTGDIAAEMLADAGATAIIVGHSERRADHGEGDALIRQKAEAAW
RAGVTAIVCVGETQGQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
AQDVEQIHSFIRELLTSRFRADGARMRILYGGSVKPSNAAELMSVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccaaccgaccgctgatcgccggcaattggaaaatgaacggcctcaagggc
tcggctgccgaattcgacgccatgctcaagggggcggcagaggtggccgccaaggccgac
ctgctggtctgcccgccggcgaccctaatcacggccttcgccgacaaggcgcgcggcagc
aaggtcgcggtgggggcgcaggattgccatcccaaggcctccggcgcccataccggcgat
atcgccgccgaaatgctggccgatgccggtgcgaccgccatcatcgtcggtcattccgag
cgtcgcgccgaccacggcgagggcgatgccctgatccggcagaaggccgaggccgcctgg
cgcgccggcgtcaccgcgatcgtctgcgtcggtgagacgcaaggccagcgcgatgccggc
cagaccctcgacatcctgcgcggccagctcgacgggtcgctgccggacggctcgaccgcc
gccaacctggtcgtggcctatgagccggtctgggcgatcggcaccggcctgaccccgacg
gcccaggatgttgagcagattcatagctttatccgggaacttctgacctcccggttcagg
gcggacggggccaggatgcgcatcctctatggcggctcggtcaagccgtcgaacgcggcc
gagctgatgtccgtgaaaaacgtcaacggcgcgctggtcggcggcgccagcctgaaggcg
gccgatttccttgcgattgcgaagggctgcccctag

DBGET integrated database retrieval system