KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49320Help
Entry
BJ6T_49320        CDS       T01848                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00010  Glycolysis / Gluconeogenesis
bju00020  Citrate cycle (TCA cycle)
bju00620  Pyruvate metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
Module
bju_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJ6T_49320
   00020 Citrate cycle (TCA cycle)
    BJ6T_49320
   00620 Pyruvate metabolism
    BJ6T_49320
Enzymes [BR:bju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BJ6T_49320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: BAL10194
UniProt: G7D9A3
Position
5013361..5014734
Genome map
AA seq 457 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAIDEGTIAKIL
VPEGTQDVPVNDVIAVLAGEGEDVKAAGAAKPSASAAPPKAAEAPAAAPAPAAAPAPAAA
PAAPKAAPPPAAAPAPQAAAPAAQSNGHGGRVFSSPLARRLAKDAGIDVSMVTGTGPHGR
VVARDVEQAKSGKGLKAPAAAPSGAPSIAPTMSDKQILSLFEPGSYEIVPHDGMRRTIAQ
RLTASIQNVPHFYLTIDCDIGKLLAAREEINAAAPKDKEKKPLYKISVNDFVIKAMAVAL
QRIPNCNVSWTESGMVKHHHSDVGVAVAMPGGLITPIIRKAETKTLSTISNEMKDFAARA
RSRKLKPEEYQGGTTAVSNLGMFGISHFTAVINPPHATILAVGTSEERPVVRGGKIEIAH
MMSVTLSCDHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaacatcctgatgcccgctctctcgccgacaatggagaagggcaacctcgcc
aagtggctgaagaaggaaggcgacaaggtcaaatccggcgacgtcatcgccgagatcgag
accgacaaggcgaccatggaggtcgaggcgatcgatgaaggcacgatcgccaagatcctc
gtgcccgagggcacgcaggacgtcccggtcaacgacgtgatcgcggtgctggccggcgag
ggcgaggacgtgaaggcggctggtgccgccaagcccagcgcctcggccgcacctccgaaa
gctgctgaagcgcccgccgccgcgccggctcccgccgccgcgccggctcccgcagctgcg
cctgccgcgcccaaggctgcgccgccgcctgccgctgcaccggcgccgcaggccgcagct
ccggccgcgcagagcaacggccatggcggccgcgtgttctcatcgccgctcgcgcgccgt
cttgccaaggacgccggcatcgacgtgtcgatggtgaccggtaccggtccgcacggccgc
gtggtcgcgcgcgacgtcgagcaggccaagtccggcaagggcctgaaggcgcctgccgct
gcgccgtccggggcgccctcgatcgcgccgaccatgtcggacaagcagatcctgtcgctg
ttcgagcccggctcctacgagatcgtcccgcatgacggcatgcgccgcacgatcgcgcag
cgcctgactgcgtcgatccagaacgtcccgcacttctacctcaccatcgactgcgacatc
ggcaagctgctcgccgcgcgcgaggagatcaacgcggctgctcccaaggacaaggagaag
aagccgctctacaagatctcggtcaacgacttcgtcatcaaggcgatggccgttgcgctc
cagagaatcccgaactgcaatgtcagctggaccgaaagcggcatggtcaagcaccaccat
tccgacgtcggtgtcgccgtggcgatgcccggtggcctgatcacgccgatcatccgcaag
gcagagaccaagacgctctccaccatctccaacgagatgaaggattttgccgcgcgcgcc
cgctcgcgcaagctgaagcccgaggaataccagggcggcaccaccgcggtctccaacctc
ggcatgttcggcatcagccacttcaccgccgtgatcaacccgccgcatgcgacgatcctc
gcggtcggcaccagcgaagagcggccggtcgtgcgtggcggcaagatcgagatcgcgcac
atgatgagcgtgaccttgtcctgcgatcaccgcgccatcgacggcgcgcttggcgccgag
ctgatcggcgcgttcaagcagctgatcgaaaatcccgtcatgatgatggtctga

DBGET integrated database retrieval system