KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_49350Help
Entry
BJ6T_49350        CDS       T01848                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00260  Glycine, serine and threonine metabolism
bju00750  Vitamin B6 metabolism
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01230  Biosynthesis of amino acids
Module
bju_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJ6T_49350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BJ6T_49350
Enzymes [BR:bju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BJ6T_49350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAL10197
UniProt: G7D9A6
Position
5016617..5017858
Genome map
AA seq 413 aa AA seqDB search
MHDNDNLTIERPTFVTHLECAMEGDHYAADQVHNLSKAGKPLLVRYDLAGVKKALTKDAL
AQRPGDMWRYRELLPVRKCKDIVSLGEVTTPLIRLPKLGAKLGGGEIIVKDEGRLPTGSF
KARGLVMAVSMGKALGIKHMAMPTNGNAGAALAAYATSCGIKTTIFCPADTPEVNVSEIE
LQGATVYRVNGYIDDCGKIVGEGKAKVGWFDTSTLKEPYRIEGKKTMGLELAEQLGWDVP
DVIFYPTGGGTGLIGMWKAFDELEKIGFIGSKRPRMVAVQASGCAPMVRAYDAGTEHATR
WEDAHTIASGIRVPQAIGDFLILRAVRQSKGFAIAVDDDKISAALNEVAREEGLLLCPEG
AATYAAYKDSLADGRVSKTDRVMLFNCATGLKYPLPPVTRTLDRHKPIDYTQF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataacgacaatctcaccatcgaacgcccgaccttcgttacgcacctcgaatgc
gcgatggagggcgatcattacgccgccgaccaggtccacaatctttccaaggccggcaag
ccgctattggtgcgctacgacctcgcgggcgtgaagaaggcgctgaccaaggatgcgctt
gcccagcgtcccggcgacatgtggcgctaccgcgagctcttgcccgtgcgcaaatgcaag
gacatcgtctcgctcggcgaggtcacgacgccgctgatccggctaccgaagctcggcgcc
aagcttggcggcggcgagatcatcgtcaaggacgagggacgcctgccgaccggctcgttc
aaggcgcggggcctcgtgatggcggtgtcgatgggcaaggcgctcggcatcaagcacatg
gcgatgccgaccaacggcaatgccggcgcggcgctcgcggcctacgcgacctcctgcggc
atcaagaccacgatcttctgcccggccgacacgccggaagtgaacgtgagcgagatcgag
cttcagggcgcgaccgtctatcgcgtcaacggctatatcgacgattgcggcaagatcgtc
ggcgaaggcaaggcaaaagtcggctggttcgacacgtccacgctcaaggagccgtaccgt
atcgagggcaagaagacgatgggcctggagctcgccgagcagctcggctgggacgtgccc
gacgtgatcttctatccgaccggcggcggcactggcctgatcggaatgtggaaggctttc
gacgagctggagaagatcgggttcatcggctccaagcgcccgcgcatggtcgcggtgcag
gcgtcgggctgcgcgccgatggtgcgggcctatgacgccggcaccgagcatgcgacgcgc
tgggaagacgcccacacgattgcgtcgggcatccgcgtgccgcaggcgatcggcgatttc
ctgatcctgcgtgccgtgcgtcagagcaagggttttgccatcgcggtcgacgacgacaag
atctcggcggcgctgaacgaggtcgcacgcgaggaggggctgctgctctgtcccgagggc
gccgcgacctacgccgcctacaaggacagccttgccgacggccgcgtcagcaagaccgac
cgcgtgatgctgttcaactgcgcgacgggcctgaagtacccgctgccgccggtgacccgc
acgctcgatcgccacaagccgatcgactacacgcagttctag

DBGET integrated database retrieval system