KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_57750Help
Entry
BJ6T_57750        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bju  Bradyrhizobium japonicum USDA 6
Brite
KEGG Orthology (KO) [BR:bju00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BJ6T_57750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAL11030
UniProt: G7DI36
Position
complement(5843751..5844758)
Genome map
AA seq 335 aa AA seqDB search
MDAALGLPVLVGLIAVALLFDFLNGLHDAANSIATIVSTRVLRPQFAVLWAAFFNFIAFM
VFGLHVAQTIGTGIIDPAVVDAQVIFAALVGAIVWNLVTWGLGIPSSSSHALIGGLVGGG
MAKAGISAAVWSGLSKAVLAIVLSPLVGFLLAMMLVAIVSWLSVRSTPFAVDRAFRILQF
ASASLYSLGHGGNDAQKTMGIIAVLLYSQGHLGGEFSVPFWVVLSCQAAMALGTLMGGWR
IVRTMGLRITKLTPMQGFCAETGGAATLFMATFLGVPVSTTHTITGAIVGVGAARRVSAV
RWNVASSIVYAWVITIPASAIVAALTWWAVQIFVR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggatgctgcgctcggacttcctgtcctcgtcggcttgatcgccgtcgcgctgctgttc
gacttcctgaacggtctgcacgacgccgccaattcgatcgcgaccatcgtttcgacccgc
gtgctgcggccgcaattcgcggtgttgtgggccgcgttcttcaatttcatcgccttcatg
gtgttcgggctgcatgttgcccagaccatcggcaccggcatcatcgatcccgcggtggtc
gacgcgcaggtgatcttcgcggcgctcgtcggcgcgatcgtctggaacctggtgacctgg
gggctcggcatcccatcctcctcctcgcatgcgctgatcggcggtctcgtcggcggcggc
atggccaaggccgggatttcggcggcggtgtggagcggcctgtccaaggcggtgctggcg
atcgtgttgtcgccgctggtcggcttcctgctcgcgatgatgctggtcgcgatcgtgtcc
tggctctcggtgcgctcgacgccgttcgcggtcgatcgcgccttccgtatcctgcaattc
gcctccgcctcgctttattcgctgggccacggcggcaatgacgcccagaagaccatgggc
atcatcgccgtgctgctgtattcgcaagggcatctcggcggcgaattctcggtgccgttc
tgggtggtgctgtcctgccaggccgcgatggcgctgggcacgctgatgggcggctggcgc
atcgtccgcaccatgggcctgcgcatcaccaagctgacgccgatgcagggcttttgcgct
gagaccggcggcgccgcgaccctgttcatggcgaccttcctcggcgttcccgtctcgacc
acccacaccatcaccggcgcgatcgtcggcgttggcgcggcccgccgcgtctcggcggtg
cgctggaacgtcgcgagctcgatcgtctatgcctgggtgatcacgatcccggcctcggcc
atcgtcgcggcgctgacctggtgggcggtccagattttcgtcaggtga

DBGET integrated database retrieval system