KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_59120Help
Entry
BJ6T_59120        CDS       T01848                                 

Definition
(GenBank) acetyl CoA synthase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00071  Fatty acid degradation
bju00072  Synthesis and degradation of ketone bodies
bju00280  Valine, leucine and isoleucine degradation
bju00310  Lysine degradation
bju00362  Benzoate degradation
bju00380  Tryptophan metabolism
bju00620  Pyruvate metabolism
bju00630  Glyoxylate and dicarboxylate metabolism
bju00640  Propanoate metabolism
bju00650  Butanoate metabolism
bju00900  Terpenoid backbone biosynthesis
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
bju01212  Fatty acid metabolism
bju02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJ6T_59120
   00630 Glyoxylate and dicarboxylate metabolism
    BJ6T_59120
   00640 Propanoate metabolism
    BJ6T_59120
   00650 Butanoate metabolism
    BJ6T_59120
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_59120
   00072 Synthesis and degradation of ketone bodies
    BJ6T_59120
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJ6T_59120
   00310 Lysine degradation
    BJ6T_59120
   00380 Tryptophan metabolism
    BJ6T_59120
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJ6T_59120
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJ6T_59120
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJ6T_59120
Enzymes [BR:bju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJ6T_59120
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJ6T_59120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAL11167
UniProt: G7DJV7
Position
complement(5972543..5973718)
Genome map
AA seq 391 aa AA seqDB search
MTMTASIVGWAHTPFGKFDTETVESLVTRVANEAIADAGISASDVDEIVLGHFNAGFSPQ
DFTASLVLQADPKLRFKPTTRVENACATGSAAVHQGLRAIDAGAARIVLVVGVEQMTRTP
GPEIGKNLLKASYLPEDGDTVGGFAGVFGKIASSYFQKYGDQSDALALIAAKNHKNGVAN
PFAQMRKDFGFEFCRAESEKNPYVAGPLKRTDCSLVSDGAAALVLADAETAKGMSKSIGF
RATAHAQDFLPMSKRDILQFEGCTVAWQRALEKAGVALTDLSFVETHDCFTVAELIEYEA
MGLTPKGQGARAIKEGWTLKDGKLPVNPSGGLKAKGHPIGATGVSMHVMTAMQLAGQAPE
GMQLKNAKLGGIFNMGGAAVANYVSVLEPLK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccgccagcatcgtcggatgggcgcatacgccgttcggcaagttcgacacc
gagaccgtcgaaagcctcgtcacccgcgtggccaatgaggcgattgccgatgccggcatt
tccgcgtccgacgtcgatgagatcgtgctcggccatttcaacgccggcttctcgccgcag
gattttaccgcctcgctggtgctccaggccgacccgaagctgcgcttcaagccgacgacc
cgcgtcgagaatgcctgcgccaccggctccgccgcggtgcatcagggcctgcgtgcgatt
gacgcaggcgcggccaggattgtgctcgtcgtcggcgtcgagcagatgacccgcaccccg
gggcctgagatcggcaagaacctgctcaaggcgtcctatctgccggaagacggcgacacc
gtcggcggcttcgccggcgtgttcggcaagatcgccagctcctatttccagaaatacggc
gaccagtccgatgcgctggcgctgatcgcggccaagaaccacaagaacggcgtcgccaat
ccctttgcccagatgcgcaaggactttggcttcgagttctgccgcgccgagagcgagaag
aacccctacgtcgcgggtcccctgaagcgtaccgactgctcgctggtctccgacggcgcc
gcggcgctcgtgctggccgatgccgagaccgccaagggcatgagcaagtcgatcggcttc
cgcgccactgcgcacgcccaggacttcctgccgatgtccaagcgcgacatcctccagttc
gagggctgcacggtcgcctggcagcgcgcgctggagaaggcgggcgttgcgctcaccgat
ctctccttcgtcgagacccatgactgcttcaccgtcgccgagctgatcgaatacgaagcg
atgggcctgacgccgaaggggcagggcgcccgcgccatcaaggaaggctggaccctcaag
gacggcaagctgccggtcaatccgtccggcggcctgaaggccaagggccacccgatcggc
gccaccggcgtctccatgcacgtgatgaccgcgatgcagctcgccggccaggcgcccgag
ggcatgcagctgaagaacgccaagcttggcggcatcttcaatatgggcggcgcagcagtt
gccaactacgtctcggtgctggagccgctgaagtaa

DBGET integrated database retrieval system