KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_74090Help
Entry
BJ6T_74090        CDS       T01848                                 

Definition
(GenBank) fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00071  Fatty acid degradation
bju00280  Valine, leucine and isoleucine degradation
bju00281  Geraniol degradation
bju00310  Lysine degradation
bju00362  Benzoate degradation
bju00380  Tryptophan metabolism
bju00410  beta-Alanine metabolism
bju00640  Propanoate metabolism
bju00650  Butanoate metabolism
bju00903  Limonene and pinene degradation
bju00930  Caprolactam degradation
bju01040  Biosynthesis of unsaturated fatty acids
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01120  Microbial metabolism in diverse environments
bju01130  Biosynthesis of antibiotics
bju01200  Carbon metabolism
bju01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BJ6T_74090
   00650 Butanoate metabolism
    BJ6T_74090
  Lipid metabolism
   00071 Fatty acid degradation
    BJ6T_74090
   01040 Biosynthesis of unsaturated fatty acids
    BJ6T_74090
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJ6T_74090
   00310 Lysine degradation
    BJ6T_74090
   00380 Tryptophan metabolism
    BJ6T_74090
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJ6T_74090
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJ6T_74090
   00281 Geraniol degradation
    BJ6T_74090
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJ6T_74090
   00930 Caprolactam degradation
    BJ6T_74090
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BJ6T_74090
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BJ6T_74090
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BJ6T_74090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 2-Hacid_dh_C NAD_Gly3P_dh_N DLH ApbA
Motif
Other DBs
NCBI-ProteinID: BAL12656
UniProt: G7D8H7
Position
complement(7637495..7639591)
Genome map
AA seq 698 aa AA seqDB search
MDSRIMTALGDRVLELGPGLATDSPYRHFKLTRDADGVAWLLFDRADASANTLSADVMEE
FDAVLAAIETERPAGLVIRSAKPSGFIAGADVNEFRGASDPEMVETRIRAAHAVVDHLEA
LKLPTVAVIHGFCLGGGLEVALACQSRIAIDGARFGFPEVMLGLHPGLGGTARFTALVNP
TQSMALMLTGRTIDARRARSLGLVDTVTQERHVRNAVKDALFGRLKRARPGLLTHAANFG
PVRGLLARRMRSEAAKAASREHYPAPYALIDLWETHGGNKAAMLKAEQASFARLMVTPTA
QNLIRVFFLREQMKRTAGSGNAVKHVHVIGAGAMGGDIAAWCAGQGLRVSLADMKAEPVA
GAVKRAADLYGKIIRKPTEVRDALDRLIPDMDGEGVRNADLIIEAVPEKLELKQKVYAGL
EPKMKPGAILATNTSSIPLQDLRTTLARPERLVGLHFFNPVSRLQLVEVVSHDGNDAQVL
KEALAFVGAIDRLPLAVKSSPGFLVNRALTPYMLEAMVMLDEKIDQRLIDAAAEQFGMPM
GPIELADQVGLDICLDVGDMLRTKFGDLLPPTPAWLREKVAKGELGRKTGKGFYTWKDGK
AEKAPLPETGPRVTDQMIDRLVLPMSNVCVAALREGIVDDADGVDGAMIFGTGYAPFRGG
PLNYARTRGVENVVSTLRALADRFGGRFAPDPGWDNFK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggattccaggatcatgaccgcactcggcgatcgcgtgctggagcttgggcccgggctc
gcgaccgacagcccctacaggcacttcaagctgacgcgcgatgccgacggcgtcgcctgg
ctgctgttcgaccgcgcagatgccagcgccaacacgctgtccgcggacgttatggaggag
ttcgatgccgtgctcgcggcgatcgagaccgaacgtcccgcaggcctcgtgatccgctcg
gcaaagccgtccggcttcattgccggcgccgacgtcaacgaattccgcggtgccagcgat
cccgagatggtcgagacacgcatccgcgcggcgcatgcggtggttgatcatctggaggcg
ctgaagctgccgacggtcgcggtcatccacggcttctgtctcggcggcgggctggaggtc
gcgctggcctgccagtcgcgcattgcgatcgacggcgcgcgcttcggcttcccggaggtg
atgctcggcctgcatcccggcctcggcggcaccgcgcgcttcaccgcgctggtgaacccg
acccagtcgatggcgctgatgctgaccggccgcaccatcgatgcgcgccgtgccagatcg
ctcggcctcgtcgataccgtgacgcaggagcggcacgtccgtaacgcggtgaaggatgca
ctgttcggccgcttgaagcgggcgcgtccgggccttctgactcacgcggcgaatttcggt
cccgtgcgcgggctgctggccaggcgcatgcgctcggaggcggcgaaggccgcgtcccgc
gagcactatccggcgccttacgcgctgatcgatctctgggagacccatggcggcaacaag
gccgcgatgctgaaggccgagcaggcctcgttcgccaggctgatggtgacgccgaccgcg
cagaatttgatccgcgtgttcttcctgcgcgagcagatgaagaggacggcgggcagtggc
aatgcggtcaaacatgttcacgtcatcggcgccggcgccatgggcggggatatcgcggcc
tggtgtgcgggacaggggctgcgcgtctcgctcgcggacatgaaggcggagccggtcgcc
ggcgcggtgaagcgcgccgccgatctctacggcaagatcatccgcaagccgaccgaggtg
cgcgatgcgctggatcgtctgatccccgacatggacggcgagggcgttcgcaacgccgat
ctcatcatcgaggcggtgccagaaaagctcgagctgaagcagaaggtctatgcgggcctc
gagccgaagatgaagccgggcgcgatcctcgcgaccaacacgtcgagcattccgctccag
gatctgcgcaccacgctggcgcggcccgagcgcctcgtcggcctgcacttcttcaacccg
gtgtcgcggctacaactggtcgaggtcgtcagccatgacggcaacgacgcgcaggtgctg
aaggaggcgctcgccttcgtcggcgcgatcgaccgtctgccgcttgccgtgaagagctcg
cccggcttcctcgtcaaccgtgcgctgacgccctacatgctggaggcgatggtgatgttg
gacgagaagatcgaccaacgcctgatcgacgcggcggccgagcagttcggcatgccgatg
gggccgatcgagctcgccgaccaggtcggactcgacatctgcctcgacgtcggcgacatg
ctgcgtaccaagttcggcgatctgctcccgccgacgccggcctggttgcgcgagaaggtc
gccaagggcgagcttggccgcaagaccggcaagggattctacacctggaaggatggcaag
gccgagaaggcgccgttgcccgagaccggtccgcgcgtcaccgaccagatgatcgaccgc
ctggtgctgccgatgtccaatgtctgcgtcgcggcactccgcgaaggtatcgtcgacgat
gccgatggggtcgacggcgccatgatcttcggcaccggatatgcgccgttccgcggcggc
ccgctgaactacgcgcgcacgcgcggcgtggaaaatgtcgtatccaccctgcgcgcgctg
gctgaccgattcggcgggcgctttgcgcccgatccgggctgggacaatttcaagtga

DBGET integrated database retrieval system