KEGG   Bifidobacterium kashiwanohense PV20-2: AH68_03060Help
Entry
AH68_03060        CDS       T03496                                 

Definition
(GenBank) amino acid lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bka  Bifidobacterium kashiwanohense PV20-2
Pathway
bka00260  Glycine, serine and threonine metabolism
bka01100  Metabolic pathways
bka01110  Biosynthesis of secondary metabolites
bka01120  Microbial metabolism in diverse environments
bka01130  Biosynthesis of antibiotics
bka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bka00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AH68_03060
Enzymes [BR:bka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AH68_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIZ14199
UniProt: A0A0A7I5U0
Position
complement(709983..711008)
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSCTATPEIIERIEQIAQNQYPGYGNDSICESAKTKIREACSRPDAQIFFLVG
GTQTNQTIIDSITPQYAGVVAANTGHVNVHEAGAIEFTGHKVLTLPHHDGKIDANELDEY
CATFYADGNYTHMVFPGCVYISQSTEYGTLYTLDELEAIRKICTTYDMPLFIDGARLGYA
LTATGNDVTLEDIARIADVFYIGGTKVGAMFGEAVVFTHGNMPKNFVTLVKQHGALLAKG
WLLGVQFDTLFTDNLYCRIARRANDAADRIRDVLVKRGYTLTFNAPTNQIFITLDNETSE
RLQRSVRLGFMEKADDTHTVMRICTSWATTDEQVEQLIALL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgaaaacgactattcctgtacggcaacaccggaaatcatcgaacgcatc
gaacagatcgcgcagaaccaatatccgggttacggcaatgacagcatctgcgaaagcgcg
aaaaccaagattcgcgaagcatgctcccgccccgatgctcagatcttcttcctggtaggt
ggcacgcaaaccaatcagaccattatcgactccatcacaccgcagtacgccggcgtggtc
gcggcaaacaccggccacgtgaacgtgcatgaggcgggcgccatcgaattcaccggccac
aaagtgctgacgctcccccaccatgacggcaagatcgatgcgaacgagctcgatgaatat
tgcgccacgttctatgcggacggcaactacacgcatatggtattccccggatgcgtgtac
atttcacagtccactgaatatggcacactctacacgctcgacgaactcgaagcgatccgc
aagatctgcacgacgtacgacatgccattgttcatcgacggcgcacgactcggctacgcg
ctgaccgcaaccggcaacgacgtgacgcttgaagacatcgcgcgcatcgcagacgtgttc
tacatcggcggcaccaaggtgggtgccatgttcggcgaagcagtggtgttcacgcacggc
aacatgccgaagaacttcgtgacgctcgtcaagcagcatggagctttgctcgccaaggga
tggttgctgggcgtgcaattcgacacgctgttcaccgacaacttgtactgcagaatcgcc
cgccgcgccaacgatgctgccgaccgcattcgcgatgtgctcgtgaaacgcggctatacg
ctcactttcaacgcgccgaccaaccagatcttcatcacgctcgacaacgaaacttccgaa
cgtttgcagcgcagcgtgcgcctcggcttcatggaaaaggccgatgacacgcacacggtg
atgcgcatctgcaccagttgggccaccaccgacgagcaggttgagcagctgatcgcactg
ctatag

DBGET integrated database retrieval system