KEGG   Bifidobacterium kashiwanohense PV20-2: AH68_10240Help
Entry
AH68_10240        CDS       T03496                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bka  Bifidobacterium kashiwanohense PV20-2
Pathway
bka00051  Fructose and mannose metabolism
bka01100  Metabolic pathways
bka01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AH68_10240
Enzymes [BR:bka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     AH68_10240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N LPD11 DUF3025
Motif
Other DBs
NCBI-ProteinID: AIZ15347
UniProt: A0A0A7I4R7
Position
complement(2325610..2326887)
Genome map
AA seq 425 aa AA seqDB search
MSVITKVTTYDFRFPTSATFSGSDAMNPDPDYSSAYVVIATDAGDSGNGFVFTIGRGNDV
VVRAIDSMSETLIGRNVEELLDNMRLAWDLFVRDSQLRWLGPEKGVEHMAIGAVLSALWD
LKAKRAGKPLWLLLSEMEPEELVATLDFRYLTDALTPQEAIEILRAAQEGKAERIAHLKE
VGYPGYSTAAGWLGYSDEKMVRLAKQETEVMGFKQIKLKVGQNLEDDLRRLKLAREAVGP
DIAIAVDANQVWDVPQAIEWIGKFNDYDLAWVEEPTCPDDVLGHAAIQKAIDPIPVATGE
QMQNRVMYKQYLQAGSFKVMQIDATRVAGPQEIVLEYLLAKKFGVKVCPHAGGVGLCEAI
SQLAMFDYVSVSGEMEDRVVEYVDNQHEYFVHPTVIKNGRYVAPLAPGNGTEMKLDECMK
YLHKD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttattaccaaagtcaccacctatgatttccgattcccgacatcggccaccttc
tccggctccgacgccatgaaccccgatccggattattcctctgcctatgttgtcatcgcc
acggatgccggtgattccggcaacggattcgtcttcaccatcggccgcggcaatgatgtc
gtcgtccgagccatcgactccatgtctgaaacccttatcggccgtaacgtcgaggaactg
ctcgacaacatgcgtctcgcgtgggatctgttcgtgcgcgattcgcagctacgctggctt
ggccctgagaagggtgtcgagcatatggccattggtgccgtgctttcggctctgtgggac
ctcaaagccaagcgcgccggcaagccgctctggctgctcctttccgagatggagcctgaa
gagctagttgcgactctcgacttccgctacctgaccgatgctctcactccgcaggaagcc
atcgagattctgcgtgccgcccaggaaggcaaggcggaacgcatcgcccacctcaaggaa
gtcggctatccgggatattcaaccgcagctggatggctcggctattccgacgagaagatg
gtccgtttggccaagcaagagaccgaggtcatgggcttcaagcaaatcaagcttaaggtc
ggtcaaaacctcgaagacgatctgcgcaggctcaagctcgcccgtgaagcggtcggcccg
gacatcgccatcgccgtagacgccaaccaggtctgggatgtgccacaggccattgaatgg
atcggcaaattcaatgactacgatctcgcgtgggttgaggaaccgacctgcccggatgac
gtgcttggacatgctgcaatccagaaggccatcgatccaattccggtggccaccggcgaa
cagatgcagaaccgagtcatgtacaagcagtacctgcaggctggcagcttcaaggtcatg
cagattgacgcgacccgagtcgccggcccccaggaaatcgtcctcgaatacctgctcgcc
aagaagttcggcgtcaaggtctgccctcacgcgggcggtgtcggcctgtgcgaagccatc
agccaacttgcgatgttcgattatgtgtccgtctctggcgagatggaggaccgcgtcgtc
gaatacgtggacaaccagcatgagtacttcgtgcatccgaccgtcatcaagaacggacga
tacgttgcaccgctcgctccgggcaacggtacggagatgaagctcgacgaatgcatgaag
tacctgcacaaggactag

DBGET integrated database retrieval system