KEGG   Bacillus kochii: CKF48_04050Help
Entry
CKF48_04050       CDS       T05194                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bko  Bacillus kochii
Pathway
bko00020  Citrate cycle (TCA cycle)
bko00620  Pyruvate metabolism
bko00650  Butanoate metabolism
bko01100  Metabolic pathways
bko01110  Biosynthesis of secondary metabolites
bko01120  Microbial metabolism in diverse environments
bko01130  Biosynthesis of antibiotics
bko01200  Carbon metabolism
Module
bko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKF48_04050
   00620 Pyruvate metabolism
    CKF48_04050
   00650 Butanoate metabolism
    CKF48_04050
Enzymes [BR:bko01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CKF48_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: ASV66567
UniProt: A0A248TEF2
Position
complement(821234..822745)
Genome map
AA seq 503 aa AA seqDB search
MDNKLGRVKIQTLQNNIMTAEGAAEMIKDGMTLGLSGFTRAGDVKAVPVALAERAKTEDF
KVNVYTGASLGSDVDKLFAEAGILNKRLPFQADSTMRKGINKGDFLFVDQHLSHTAELIR
SGVLHVDVAILEAVSIEDDGTIVPTTSVGNSLSFAEHAHSVIVEINMAQLPSLKGLHDIY
SPDKQGERGPIPITNVADRIGEIGIKVNPEKIKAIVFTEQGDSPSTIVQPDEETVIMAQH
LTNFLRNEIAAGRLDEKLAPLQSGIGSVANAVLHGMIDSEFTDLEVYSEVLQDAVFDLID
AGKVKFASGCSITLSEEKMQEVFAHFDQYRDKLLLRPQEITNHPELIRRLGLISINTALE
LDIYGNVNSTHVQGTKMMNGIGGSGDFARNARLAIFVTKSIAKDGKVSSIVPFASHIDHT
EHDVDVIVTEQGYADLRGLAPRERVELIIENCAHPLYKDQLRDYYYEALSAGGQTPHILA
KAFSWHLNYVENGTMLASEKVDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggataataaacttgggagagttaaaattcagacacttcagaacaatatcatgactgca
gaaggggctgcagaaatgattaaagatggcatgacattggggttaagtggatttactcgt
gcgggagatgtgaaagcggttcctgtcgcattagcagaaagagcaaaaactgaagatttt
aaagtcaatgtgtatacaggcgcatctcttggatcggatgttgataagttgtttgcagaa
gccggtattttaaataagagattaccatttcaagcggactcaacaatgagaaaaggcatt
aataaaggggacttcttatttgttgatcaacatttatctcacacagcagaacttatccgt
tcaggggtattacatgtggatgtagctattttggaagcggtttcgattgaagatgacgga
acaattgtacctacaacatcagttggtaactcactgtcttttgcagaacatgcccatagt
gtaattgttgaaattaatatggcccaattaccatcactaaaagggttacatgatatttat
agtccagataaacaaggtgagcgtggtccaattccaattacaaatgtagccgatcgtatt
ggtgagataggtattaaagtgaatccggagaaaattaaagcgattgtgtttactgaacaa
ggcgattcaccttcaactattgttcagccagatgaggaaacagttattatggcacaacat
ttaaccaactttcttcgcaatgaaattgcagcagggagattagatgaaaaacttgcccca
ttacaatcaggcattggttcggtagcaaatgctgtattacatggcatgattgactctgaa
ttcacagacttagaggtgtattcagaagtacttcaagatgcagtatttgatttaattgat
gctgggaaagtaaagtttgcgtcaggttgttccattacactttcagaagaaaagatgcaa
gaagtgtttgcacatttcgatcaatatcgcgataagttattgttaagaccacaagagatc
actaatcatccggaattaattcgccgcttaggattaatctctatcaatactgcattagaa
ctagatatctatggcaatgtaaattctactcatgttcaaggaactaagatgatgaatggt
attggcggatcaggggattttgcaagaaatgcaaggttagctatattcgtgacaaaatca
attgctaaagatggaaaagtttcaagtattgtaccttttgcttcacatattgatcataca
gaacatgatgttgacgtaattgtcacagaacaaggctacgcagatttaagaggattggct
cctcgtgaacgagttgagttaatcattgaaaattgtgcgcatccgttatacaaggatcaa
cttagagattattattatgaagcattatcagcaggtggccaaaccccacatattctagcg
aaagctttttcttggcatttaaactatgtggaaaatggcacaatgttagcttcagagaaa
gtggatgtttaa

DBGET integrated database retrieval system