KEGG   Bacillus kochii: CKF48_04775Help
Entry
CKF48_04775       CDS       T05194                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bko  Bacillus kochii
Pathway
bko00361  Chlorocyclohexane and chlorobenzene degradation
bko00625  Chloroalkane and chloroalkene degradation
bko01100  Metabolic pathways
bko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKF48_04775
   00361 Chlorocyclohexane and chlorobenzene degradation
    CKF48_04775
Enzymes [BR:bko01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CKF48_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ASV66694
UniProt: A0A248TET9
Position
complement(961515..962222)
Genome map
AA seq 235 aa AA seqDB search
MKKYQYLFFDVDDTLLDFRHTEKRALERLFEQENIVLTDDIKGDYHRFNKGLWHAHERGE
IGKEELLNTRFTEFFRLHGKQVDGLTMERSYRNFLSEGHEQLDGALSLIQQLSTQYDLFI
MTNGVAQTQNRRLRDSGLFPYFKNIFISEETGFHKPMKAYFDYCFQRIDQFNCGKALIIG
DSLVADIKGGLAAGMDACWMNVAKVANDTDITPTYEINKLVELLPILERREFIDS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtatcaatatttattttttgatgtggacgacacattattagattttagacat
acggaaaaaagggcattagagcgtttgtttgaacaagaaaatatcgtattaactgatgac
ataaaaggggattatcaccgctttaataaagggttatggcatgcgcatgaacggggagag
attggcaaagaggaacttttaaacacgagatttaccgagttcttccgacttcatggaaag
caagtagacggcttaacaatggaacggagttaccgcaatttcttatccgaaggacatgaa
caattagatggagcgctctcgcttattcaacaactatcgacgcaatatgacctttttatt
atgacgaatggtgtagcgcaaacgcaaaatcgtaggttacgtgattccgggttgtttcct
tattttaaaaatatctttatctcagaagaaactggttttcataagcctatgaaagcatac
ttcgattattgtttccagcgtatagatcagtttaattgtggaaaagcactcattattggt
gattctttagtagctgatataaaaggtggtcttgctgctggaatggatgcttgttggatg
aatgttgcaaaagtagctaatgacacagacattacacccacttatgaaatcaataagtta
gtcgagctcttacctatattagaaaggagggagttcattgactcataa

DBGET integrated database retrieval system