KEGG   Bacillus kochii: CKF48_11875Help
Entry
CKF48_11875       CDS       T05194                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bko  Bacillus kochii
Pathway
bko00260  Glycine, serine and threonine metabolism
bko01100  Metabolic pathways
bko01110  Biosynthesis of secondary metabolites
bko01120  Microbial metabolism in diverse environments
bko01130  Biosynthesis of antibiotics
bko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKF48_11875
Enzymes [BR:bko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CKF48_11875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ASV67944
UniProt: A0A248TIA4
Position
2309801..2310856
Genome map
AA seq 351 aa AA seqDB search
MINYLSDTITLPTDAMMQSIQEAKLGDDVYGQDETVNHLEEFAAKLTGKEAACFMPSGTM
ANLASIMAYCPRGTKALVGDESDIYIFEAGGASVCGGIMYEPIRTQSDGSLSIEDLTNAI
PIDKNDPQFALPALICLENTHNRCGGKALSLDYLSEIKRFGDENHIPIYMDGARVFNAAL
SLGVDIKEITQHVDSLQFCLSKGLSAPVGSIVSGTKQHINEVRRIRKMLGGGMRQAGILA
APALVALQTMIDRLTEDHQKAKRLAKELEAIDGIEVETKDVHSNIIMFKIINENFTWKSF
LEAAEKNNVIFSEMGYGRIRAVIHRHITDDDITSTIKIIKEILHSNIIKAY
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattatttaagtgatacaattacgttgccaacagatgccatgatgcaatcaata
caagaagcaaagctaggtgatgatgtctatgggcaggatgaaacagtaaatcatcttgaa
gaatttgctgcaaagttaacagggaaagaagcggcctgctttatgccgagtggtacaatg
gcgaatttagcatctatcatggcttactgtccaagaggaacaaaagcactcgttggtgat
gaatctgatatctatatttttgaagctggaggagcttcagtttgcggggggattatgtac
gaacctattcgtacacagtcagatggaagtctctctatagaagatttaaccaacgctatt
ccaatcgataagaacgatcctcaatttgctctgccggcgttaatctgtcttgagaataca
cataacaggtgtggagggaaagcgttaagcttagattacttaagtgagataaagcgtttt
ggggatgaaaatcatatccctatctatatggacggggcccgtgtctttaatgcagctctc
tcattaggtgtcgatataaaagagattacacagcatgtggactctttacaattttgttta
tcaaaagggttatcggcacctgtaggctcaattgtatcaggtacaaaacaacacattaac
gaagtacgaagaattagaaaaatgttgggtggaggaatgcgccaggcgggaattttagca
gctcccgccttggtggcccttcaaaccatgatagatagactgacagaagatcatcagaaa
gcgaaaagacttgcgaaagaattagaagcgattgatgggattgaggttgaaacaaaggat
gtacattcaaatataatcatgttcaaaatcattaatgaaaatttcacttggaagtcattt
cttgaggctgcagaaaaaaataatgtaatattttctgagatgggatatggtagaatacga
gcggttattcatagacatattacagatgacgatatcacttcaacaattaagatcataaaa
gagatactacattctaatattattaaagcctactag

DBGET integrated database retrieval system