KEGG   Bacillus kochii: CKF48_16740Help
Entry
CKF48_16740       CDS       T05194                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bko  Bacillus kochii
Pathway
bko00471  D-Glutamine and D-glutamate metabolism
bko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CKF48_16740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bko01011]
    CKF48_16740
Enzymes [BR:bko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CKF48_16740
Peptidoglycan biosynthesis and degradation proteins [BR:bko01011]
 Precursor biosynthesis
  Racemase
   CKF48_16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ASV68788
UniProt: A0A248TKN5
Position
3286735..3287532
Genome map
AA seq 265 aa AA seqDB search
MKQPIGIIDSGVGGLTVAKEVMRQLPNENIIYLGDTARCPYGPRSGEEVKEFTWQMTKFL
LEKEVKMLIIACNTATAVALDDIKNELPIPVIGVIFPGARTALKVTENHIIGIIGTAGTV
KSRAYELALKGINNRTVVHSLACPKFVPLVESGEYESVFAKKIVLETLGPLTNKGLDTLI
LGCTHYPLLENLVKQVMGEGVNVISSGDETAREASTILYDRGFLNTSEEDPQHRFFTTGS
EAMFKDIATKWLHREINDVERIQLG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaccgataggtattattgattcaggggttggcgggttaactgttgcaaaggaa
gtgatgcgtcagttacctaatgaaaatattatttacttaggagatacagctcgatgtcca
tatggtccgaggtctggagaagaagtaaaagaattcacatggcaaatgacgaagttttta
ttagaaaaagaagtgaagatgctcattattgcctgtaatactgcgactgctgttgcatta
gatgatattaagaatgagttaccaattccggtcattggcgttatttttcctggagcaaga
acggcgctaaaagtaacagaaaatcatatcattggcatcattggtacagcgggaacggtg
aagagtcgtgcttatgaactcgcattaaaagggatcaataatcgtacggtagttcatagc
ctagcttgtcctaaatttgtcccactagtagaaagtggggagtacgagagtgtatttgcg
aaaaaaatcgttctagaaacgttagggccattaacaaataaaggtttagacacattgata
ttaggctgtacacattatccgctgttggagaatcttgttaagcaagtgatgggtgaaggt
gttaacgtgattagttccggagatgaaaccgctcgagaagcaagcacgattctttatgat
cgcggctttttaaacacgagtgaagaagatcctcagcaccgttttttcacaacaggttct
gaagcgatgttcaaagacattgcaacaaaatggttgcatagagagataaacgatgtggag
cgcatacaactcggataa

DBGET integrated database retrieval system