KEGG   Bacillus kochii: CKF48_17240Help
Entry
CKF48_17240       CDS       T05194                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bko  Bacillus kochii
Pathway
bko00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bko00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CKF48_17240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bko01007]
    CKF48_17240
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bko03016]
    CKF48_17240
   03029 Mitochondrial biogenesis [BR:bko03029]
    CKF48_17240
Enzymes [BR:bko01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     CKF48_17240
Amino acid related enzymes [BR:bko01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CKF48_17240
Transfer RNA biogenesis [BR:bko03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CKF48_17240
 Prokaryotic Type
   Other AARSs
    CKF48_17240
Mitochondrial biogenesis [BR:bko03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CKF48_17240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ASV68882
UniProt: A0A248TL63
Position
3394483..3396258
Genome map
AA seq 591 aa AA seqDB search
MFGRTYYCGEITEKAIGEKVTLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPEVSQEAL
ALAEKIRNEYVLDIEGVVIEREQGTVNESLTTGKIEIRVEKVTILNEAKTPPFTIDEKSE
VSEDVRLKYRYLDLRRPVMANTLKLRHQVTKAIRGFLDDADFIDVETPILTKSTPEGARD
YLVPSRVHPGEFYALPQSPQIFKQLLMVSGVDRYYQIARCFRDEDLRADRQPEFTQIDIE
MSFMSQEDIIELMESMMAKIMKDVKGQEVHIPFPRLTYHEAMSRYGSDKPDTRFEMELTD
LSDIVKDSSFKVFAGAVSSGGQVKAINVKGAASTYSRKDIDALTEFVSVYGAKGLAWLKA
EEEGLKGPIAKFVSEEEQAAIQSVLGVEAGDLLLFVADKKSVVADALGALRLKLGKQLEL
IDESKFNFLWVTDWPLLEYDEEDGRYYAAHHPFTMPQRQDLEKLADQPGEVKAQAYDLVL
NGYELGGGSLRIFERDIQERMFEILGFSKEEAVEQFGFLLEAFDYGTPPHGGIALGLDRL
VMLLAGRTNLRDTIAFPKTASASCVLTDAPGEVSEAQLNDLHLALNVKNQD
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaagaacgtactactgcggagagattaccgaaaaagcgataggtgagaaagta
acattaaagggttgggtgcaaaaacgtcgtgatttaggaggtcttatctttattgaccta
cgtgacagaacaggcatagtccaagttgtctttaatccggaagtttcacaagaagcttta
gcattagcagaaaaaattcgtaacgaatatgtgttagatattgaaggcgtcgttattgaa
agggaacaagggacggttaatgagagcttaacaactggtaaaattgaaattcgagtggaa
aaagtaacgattcttaatgaggcgaaaacacctccatttacaattgacgaaaaatctgaa
gtatctgaggatgttcgcttaaaatatcgttatctagatttaagaagaccagtaatggcc
aatacattaaagctacgccatcaagtaacaaaagctattagaggattccttgatgatgct
gattttatcgatgtagagacaccaatcttaacgaagagtacaccagaaggagcgcgcgat
tatttagtgccaagtcgtgtgcatccaggagagttttacgcgctgccacaatcgccacaa
atatttaaacaattattaatggtcagtggagtagaccgttattatcaaattgctcgttgc
ttccgagatgaagatttacgcgcagaccgtcaaccggagtttacgcaaattgatattgaa
atgagctttatgagccaagaagatattattgagttgatggaaagtatgatggctaaaatc
atgaaggatgtaaaaggacaagaagttcatatcccattccctcgtttaacctatcatgaa
gctatgtcaagatacggttccgataagccagatacacgttttgaaatggagctaacggat
ttatctgatatcgtaaaggattcgagctttaaagtatttgctggtgctgtatcatcaggt
ggacaagtgaaagcaatcaacgtcaaaggcgctgcttccacctattcccgcaaagatatt
gatgccttgacggaatttgtttcggtatacggggctaaaggacttgcttggttaaaagca
gaagaagaaggtttaaaaggcccaattgctaaatttgtatctgaagaagaacaagcagcg
attcagtcagtacttggtgtagaagctggcgacctattactattcgttgcggataaaaaa
tcagtagttgctgatgcattaggtgcgcttcgtctaaaattaggtaagcaattagaatta
attgatgaaagcaaatttaacttcttatgggtaacggattggccgctacttgagtatgac
gaagaagatggtcgctattatgcagcacatcatccttttacaatgccacaaagacaagat
ttggaaaaattagctgatcagcctggagaagtaaaagctcaagcgtatgacctagttctt
aatggctatgaacttggcggtggttccctacgtatattcgaaagagatattcaggagcga
atgtttgaaattcttggtttttctaaagaggaagctgtcgagcaatttggtttcctactt
gaagcatttgactatggtactccgccacatggagggattgcactaggacttgatcgtcta
gtaatgttacttgctggtagaacgaacctaagagatacaattgctttccctaaaacagct
agtgcaagttgcgttttaacagatgcacctggggaagtaagtgaagcacaattaaatgat
cttcatctcgctttgaatgtaaagaatcaagattaa

DBGET integrated database retrieval system