KEGG   Bacillus kochii: CKF48_20570Help
Entry
CKF48_20570       CDS       T05194                                 

Definition
(GenBank) (2,3-dihydroxybenzoyl)adenylate synthase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
bko  Bacillus kochii
Pathway
bko01053  Biosynthesis of siderophore group nonribosomal peptides
bko01110  Biosynthesis of secondary metabolites
bko01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    CKF48_20570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bko01008]
    CKF48_20570
Enzymes [BR:bko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     CKF48_20570
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     CKF48_20570
Polyketide biosynthesis proteins [BR:bko01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    CKF48_20570
   Bacillibactin synthetase
    CKF48_20570
  Nonlinear NRPS
   Vibriobactin synthetase
    CKF48_20570
   Myxochelin synthetase
    CKF48_20570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ASV69496
UniProt: A0A248TMR4
Position
4061094..4062710
Genome map
AA seq 538 aa AA seqDB search
MLQGYTPWPDELATKYRSNGCWTGETFGEVLERMATLTPTSIALIEGNRKVTYEELNDRA
NRLAHGFIHLGIKKQDRVVLQLTNTITFFEVCFALFRMGALPIFSLPLHRQTEITYFCEH
TKAVAYVIPDVFDRHDYVKMAREVKGKVNTLQHIIVAGDEQEFLNVEALMSEESVNLPNI
SGSDLAFFQLSGGSTGLPKLIPRTHDEYLYSIRKSVEICELSERTKYLAVLPVAHNFTMS
SPGVFGVLYAGGCIILSPDPSPDTAFPLIEKEKVNFTSLVPPLAIIWIEAKKSRGYDLTS
LEVIQVGGAKCSAEVAKKVGPSFGCSLQQVFGMAEGLVNYTRLDDTDEKIVYTQGRPMSE
FDEIRIVDEEDQSIAVGDTGHLQVRGPYTIIAYYNAETHNEKAFTHDGFYRTGDIVKQTE
DGYLIVEGRDKDQINRGGEKIAAEEVENYLLSHEDVLDAAIVSMPDAFLGERSCAFIISQ
NEQLTGQALKSFLQLKGIAAFKIPDRFEFVHEFPQTPLGKVSKKSLREIIQEKLATKI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggatatacaccttggccagatgaattggcaacaaaatatcgctcaaatgga
tgctggactggtgaaacttttggtgaagtattagaaaggatggcaacattaacaccgaca
tccattgcactgattgaaggaaatcgtaaagttacgtatgaagagttaaatgatagagcc
aatcgcttagcccatggattcatccatcttgggataaagaagcaagatcgagtagtattg
caacttaccaataccattaccttttttgaagtttgttttgcgctattccgtatgggggct
ctccctattttctctttgccattgcatcgacaaacagaaattacttacttttgtgaacat
acaaaagccgttgcttatgtgatacctgatgtttttgatagacatgattatgtgaagatg
gccagagaagtgaaaggaaaagtcaatacattacaacatattattgtcgcaggagatgag
caggagtttttaaacgttgaagcactaatgtctgaagaatctgtgaatctaccaaatatt
tcgggtagtgacttagcatttttccaattatctggtggaagtactgggttgcctaagtta
attccgagaacacatgatgagtatttatatagtattcgaaaaagtgtagaaatctgtgaa
ttaagtgaaaggacgaaatatctagctgtattaccagtagcacataacttcacgatgagt
tcacctggtgtttttggtgtcttatatgctggtgggtgcatcattttaagtcccgatcct
agtccagatacggcatttccattaatcgaaaaagaaaaagtcaactttacatcactcgtt
cctccgctagcaattatttggattgaggcaaagaagtcaagaggttatgatcttactagc
ttagaggtgattcaagtaggtggggcaaaatgtagtgctgaagtagcgaaaaaagtggga
cctagctttggctgttcactacaacaagtttttggcatggctgaaggattggttaattat
acgagattagatgatacagatgagaaaatcgtttatacacaagggagaccaatgtctgaa
tttgatgagattcgtattgtagatgaagaggatcagtctattgccgttggtgatacgggc
catttacaagtaagaggaccttacacgataattgcctattacaatgcagagactcataac
gaaaaagcatttactcatgatggcttttatcggacaggagatattgttaaacaaacggaa
gatggttatttaatcgtagaaggaagagataaggaccaaattaatcgtggtggagaaaag
attgctgctgaagaggttgagaattatttgctctcacatgaagatgtattagatgcagca
attgtcagtatgccagatgcattccttggtgaaagatcttgtgcatttattatctcgcaa
aacgaacagctgacaggtcaagctttgaagtcgtttctacaattaaaaggaattgccgca
tttaagatacctgaccgttttgaatttgtacatgagtttccacaaacaccacttggaaaa
gtaagtaaaaaaagcttaagagaaatcatccaagaaaaattagctactaaaatataa

DBGET integrated database retrieval system