KEGG   Bifidobacterium kashiwanohense JCM 15439 = DSM 21854: BBKW_0875Help
Entry
BBKW_0875         CDS       T04223                                 

Definition
(GenBank) putative glycosyltransferase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
bks  Bifidobacterium kashiwanohense JCM 15439 = DSM 21854
Pathway
bks00500  Starch and sucrose metabolism
bks01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bks00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBKW_0875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bks01003]
    BBKW_0875
Enzymes [BR:bks01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     BBKW_0875
Glycosyltransferases [BR:bks01003]
 Polysaccharide
  Storage polysaccharide
   BBKW_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_trans_1_2 Glyco_transf_5 Glyco_trans_4_2 DUF3492 Inj_translocase
Motif
Other DBs
NCBI-ProteinID: BAQ29010
Position
1049022..1050278
Genome map
AA seq 418 aa AA seqDB search
MKVEILSREYPPKVYGGAGVHAEELSKVLAERVDVTVRAFDGPRAEDEIPKIPGDDPKGS
LKVIGYDVPRELQEANGALKTFGVDLQIANDVDADIIHAHTWYVCLAGYLAKMLHGTPLV
ITAHSLEPFRPWKREQLGGGYDLSSWAERDAYEHADRVIAVSAGMREDILSAYPNLDPDK
VVVVHNGITMSQFETPADDDPGWKVFERYNIDRNKPTLLFVGRITRQKGLPYLLQALHFV
DPGIQVVLCAGAPDTPEIMNEVKTAFAKLDEERGNIIWIEEMLPKPELNALEHGCDAFIC
PSIYEPLGIVNLEAMACGLPVVASATGGIPEVVVDGETGYLVPVDQLHDGTGTPTSPDKF
VHDMADAINRIMADPEKAKQMGQAGYERARDNFSWESIADKTVKVYENVLAEQSKAAE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgagattctttcccgtgaatatccgcccaaagtgtacggcggcgcaggcgtg
cacgcggaggagctttccaaagttctggcggaacgcgtggatgtgacggtccgtgcgttt
gatggaccgcgtgccgaggatgagatccccaagattccgggtgacgatcctaaagggtcg
cttaaggtcatcgggtacgacgttcccagggaactccaagaggcgaatggcgcgttgaaa
acattcggcgtcgacttgcagatcgccaacgacgtggacgccgacatcatccacgcccac
acatggtacgtgtgcctagccggctacctcgccaagatgctgcacggaacgccgctggtc
atcaccgcgcattccctcgaaccgttccgcccatggaagcgtgagcagttgggcggcggc
tacgacctgagctcgtgggctgaacgtgacgcatacgagcacgccgaccgcgtcatcgcc
gtatccgccggcatgcgcgaggacatcctgtccgcatatccgaatcttgatcccgacaag
gtggtcgtggtgcacaacggcatcaccatgagccagttcgaaactccggctgacgacgat
ccgggctggaaggtgttcgaacgttacaacatcgaccgtaataagcccacactcctgttc
gtcggtcgcatcactagacagaagggtttgccgtacctgctgcaggcgttgcatttcgtc
gatccgggcatccaggtcgtgctgtgcgccggcgcacccgacactccggaaatcatgaac
gaggtcaaaaccgcgttcgccaagcttgatgaggagcgcggcaacatcatctggatcgaa
gagatgctgccgaagccggaacttaacgcgctcgaacacggttgcgacgcgttcatctgc
ccgtccatctacgagccgctcggcatcgtgaaccttgaagccatggcctgcggtctgccc
gtggtggcctccgcgaccggcggtattcccgaagtcgtcgtcgacggtgaaaccggttac
ctcgtgcccgtcgaccagttgcacgacggtactggtaccccgaccagtccggacaagttc
gtgcacgatatggccgacgccatcaaccgcatcatggccgaccctgaaaaggcgaagcag
atgggtcaggccggatacgaacgcgcacgcgacaacttcagctgggagtcgatcgccgac
aagaccgtcaaggtttatgagaacgtgcttgctgagcagagcaaagccgccgaatag

DBGET integrated database retrieval system