KEGG   Bifidobacterium kashiwanohense JCM 15439 = DSM 21854: BBKW_1921Help
Entry
BBKW_1921         CDS       T04223                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
bks  Bifidobacterium kashiwanohense JCM 15439 = DSM 21854
Pathway
bks00460  Cyanoamino acid metabolism
bks00500  Starch and sucrose metabolism
bks01100  Metabolic pathways
bks01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bks00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBKW_1921
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BBKW_1921
Enzymes [BR:bks01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BBKW_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAQ30056
UniProt: A0A087AYI4
Position
complement(2307242..2308165)
Genome map
AA seq 307 aa AA seqDB search
MTVTNTGDTVGKIQLTDADGPASLNNNFTGVGSIGFPASTAFACTWNKDLAKQFGEMIGD
MAHDMHVAGWYAPAMNIHRGAFSGRTFEYFSEDSLLSGVMVSNEIAGAKEKGVYSFMKHF
ALNDQETNRTNMVCTWADEQAIREIYLKPFEMSGKEGGAQAVMSSFNYIGYTYAGASNNL
LNTVLRDEWGFKGFVLTDYFGGYGYQNGDQEIRNGNDSMLATTKNTNHITDKSATSVKAM
RTATHNILYTAANSWQYADGEPKVDTPIWKTAMYVAWGVTAVLAIALEALAIKRYMDRKK
AKAEVSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcaccaacactggcgacaccgtcggcaagatccagctcaccgatgctgacggt
ccagcctcgctgaacaacaacttcaccggcgttggctccatcggcttcccggcttccacc
gcattcgcctgcacttggaacaaggatctggccaagcagttcggcgagatgatcggcgac
atggctcatgacatgcacgttgctggttggtacgctccggctatgaacatccaccgtggc
gctttctccggccgtaccttcgagtacttctctgaggactccctgctctccggtgttatg
gtttccaacgagatcgccggcgctaaggagaagggcgtgtattccttcatgaagcacttc
gctctgaacgatcaggaaaccaaccgtaccaacatggtgtgcacctgggcggacgagcag
gccatccgcgagatctacctcaagccgttcgagatgagcgggaaggaaggcggcgcacag
gccgtgatgagctccttcaactacatcggttatacctatgccggtgcctccaacaacctg
ctgaacaccgtgctccgtgacgagtggggcttcaagggcttcgtcctgaccgattacttc
ggcggctacggctaccagaatggtgatcaggagatccgtaacggcaacgattccatgctg
gccaccaccaagaacaccaaccacatcaccgacaagtccgcaacctccgtgaaggccatg
cgtaccgctactcacaacattctgtacaccgccgccaacagctggcagtatgcagatggt
gagccgaaggtcgataccccgatctggaagaccgccatgtacgtggcttggggcgtgacc
gctgttctggcgatcgcactcgaggctctggctatcaagcgctacatggatcgcaagaag
gccaaggctgaagtctccgcctga

DBGET integrated database retrieval system