KEGG   Bacillus krulwichiae: BkAM31D_01180Help
Entry
BkAM31D_01180     CDS       T04947                                 

Gene name
mtlD
Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00051  Fructose and mannose metabolism
bkw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BkAM31D_01180 (mtlD)
Enzymes [BR:bkw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BkAM31D_01180 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ARK28587
UniProt: A0A1Y9THD8
Position
212407..213555
Genome map
AA seq 382 aa AA seqDB search
MRAVHFGAGNIGRGFIGLLLNESGFHTTFVDVNSEIVELLNERQEYKVVLAANSKDEVLV
NDVSAINSITEKELVIEAIAKADLVTTAVGPNILAVIAPLLAKGLSERVKENRTPLNVIA
CENLIGGSTLLKEHVYSHLSEADQALIKQLVAFPDAAVDRIVPNQSNEDKLLVMVEPYYE
WVVDESMLIGEKPAVKGITYVEELNPYIERKLFTVNTGHAVTAYLGYHYQISSIDQAVNN
DEVRVLLEQTLNETGELLVKKHGFNKEEHQTYIGKIIERFKNVYLADDVTRVGRGPLRKL
GPNDRLVGPAKQYIEVVQKQPVYLAKSIAAALHYDVKTDEEAVKVQQLLAEKGLQHAISE
ITELIPSDPLFELIVEQYQLLN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgtccattttggtgctggaaacattggaagaggttttattggtttattatta
aatgaatctggcttccatacaacatttgttgatgtaaatagtgagattgtcgaattgctt
aatgaaagacaggaatataaagttgtgctcgctgcgaattcaaaagacgaagtactagtt
aatgatgtgtcggcaattaacagtataaccgagaaagagttagtaattgaagcaatagcg
aaagccgatcttgtgacaacagctgtagggcctaatatattagctgtaattgctcctttg
cttgctaaagggttgagtgaaagagtaaaagagaaccgcacgcctcttaatgttatcgct
tgtgaaaacttaataggaggaagcacattattaaaagaacatgtgtatagccatttaagt
gaagctgatcaagcgcttattaagcaactagttgcttttcctgatgcggctgttgatcgc
attgtaccaaatcaatccaatgaagataagttacttgttatggttgaaccgtactatgaa
tgggtggtagacgagtcgatgttaattggggagaagcctgcggtgaaagggattacgtat
gtagaagagctaaacccatacattgagcgtaaattgtttactgtcaatacaggtcatgct
gttacagcctatttaggttatcattaccagatatcatcgattgatcaagctgtaaacaat
gacgaggttagagtattattagaacaaacattaaatgaaacaggcgagttactcgtgaag
aaacatggttttaataaggaagaacaccaaacgtatatagggaagatcattgagcgcttt
aaaaatgtgtatctagctgatgacgttacgcgagtagggagaggtccacttcgaaaatta
ggtcctaatgatcgtttagtaggaccggcgaagcaatacattgaagtcgttcagaaacag
cctgtttatttagcgaagtcgattgctgcagccttacactatgatgtgaaaacagatgaa
gaagctgtgaaagtccagcagctattggctgagaagggacttcaacatgccatttctgaa
attacagaattaattccttcggatccactttttgaattaattgtcgagcaatatcaatta
ttaaactaa

DBGET integrated database retrieval system