KEGG   Bacillus krulwichiae: BkAM31D_22595Help
Entry
BkAM31D_22595     CDS       T04947                                 

Gene name
nagA_3
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00520  Amino sugar and nucleotide sugar metabolism
bkw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BkAM31D_22595 (nagA_3)
Enzymes [BR:bkw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BkAM31D_22595 (nagA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ARK32425
UniProt: A0A1X9MG37
Position
complement(4108530..4109684)
Genome map
AA seq 384 aa AA seqDB search
MSSTYTKVKGLHYQTNKPIEIIMEAGKIKRMYHLLDSNDEDLPIVAPGLIDLQINGFKGI
DFNHEPLNKEQWLTVTNELAKVGVTTFYPTMITNSQDQLASLFEENKKTITEGFSNNDMI
AGFHLEGPYISREEGPRGAHPKEHVRSPNWKEFTDLQEKAGGLIKLVTLSPEWEASNDFI
QRANEHGVKVVALGHLNATEKQIDDAVRAGAVASTHLGNGAHVSLPRHPNYLWDQLAKEE
LWATVIADGHHLPTNVLKVMNLVKKEKMVLVSDAVSLAGMQPGHYHTAVGGKVTLTDEYK
LHLRGNPQILAGSAQSLLMGVNHLIVSGISTRSEALDKASILPAKLMNLPQQLGLSENAP
ADLVLLREENGELEVVETVKSGRV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacttatacgaaagtgaaagggttgcactaccaaacgaataaaccaattgaa
atcatcatggaagcaggcaaaatcaaaagaatgtatcacttacttgattcaaacgatgag
gatcttcctatcgtcgccccaggcttaattgatcttcaaattaacggattcaaaggaatc
gacttcaatcacgagcctctaaacaaggaacaatggttaaccgtaacgaacgaactagcg
aaagtcggtgtaacgaccttctaccccacgatgatcaccaactcccaagaccaactagca
agcttgtttgaagaaaacaagaaaacgatcacagagggattctctaacaatgacatgatt
gcgggctttcatttagaaggaccttatatatcaagagaagaaggaccacgtggagctcac
ccgaaagagcatgtgcgcagcccgaattggaaggagttcaccgaccttcaagaaaaggca
ggaggattgatcaaactcgttacgctctctccagaatgggaagcatccaacgactttatt
caacgagcaaacgagcatggagtgaaagtagtagcattgggccacttaaatgccactgaa
aaacaaattgatgatgccgtccgtgcaggagccgtcgcctccacccacttaggaaatgga
gcgcatgtctcactgccacgtcaccccaactacttgtgggaccaattagcaaaagaggaa
ctatgggcaaccgtcattgcagacggacaccaccttccaaccaatgtgctcaaagtgatg
aacctagtcaaaaaagagaagatggttctcgtaagtgacgccgtatccctagccggtatg
caaccaggtcactatcacacggcagttggtggaaaagtaactctcacagacgaatacaaa
ctacatttacgaggaaatccccagattctagccggatctgcccaatcactactcatgggt
gtcaatcatctgattgttagtggaatctcaactagaagtgaagcgttggacaaagcgtct
atcttaccagctaagctaatgaatctcccgcagcagttaggactatcggagaatgcaccc
gcggatttggtgttgctgagagaagagaatggcgagttggaggttgtggagacggtgaag
agtgggagggtgtga

DBGET integrated database retrieval system