KEGG   Bacillus krulwichiae: BkAM31D_24665Help
Entry
BkAM31D_24665     CDS       T04947                                 

Gene name
mmgA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bkw  Bacillus krulwichiae
Pathway
bkw00071  Fatty acid degradation
bkw00072  Synthesis and degradation of ketone bodies
bkw00280  Valine, leucine and isoleucine degradation
bkw00310  Lysine degradation
bkw00362  Benzoate degradation
bkw00380  Tryptophan metabolism
bkw00620  Pyruvate metabolism
bkw00630  Glyoxylate and dicarboxylate metabolism
bkw00640  Propanoate metabolism
bkw00650  Butanoate metabolism
bkw00900  Terpenoid backbone biosynthesis
bkw01100  Metabolic pathways
bkw01110  Biosynthesis of secondary metabolites
bkw01120  Microbial metabolism in diverse environments
bkw01130  Biosynthesis of antibiotics
bkw01200  Carbon metabolism
bkw01212  Fatty acid metabolism
bkw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bkw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BkAM31D_24665 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BkAM31D_24665 (mmgA)
   00640 Propanoate metabolism
    BkAM31D_24665 (mmgA)
   00650 Butanoate metabolism
    BkAM31D_24665 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BkAM31D_24665 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BkAM31D_24665 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BkAM31D_24665 (mmgA)
   00310 Lysine degradation
    BkAM31D_24665 (mmgA)
   00380 Tryptophan metabolism
    BkAM31D_24665 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BkAM31D_24665 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BkAM31D_24665 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BkAM31D_24665 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bkw04147]
    BkAM31D_24665 (mmgA)
Enzymes [BR:bkw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BkAM31D_24665 (mmgA)
Exosome [BR:bkw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BkAM31D_24665 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARK32797
UniProt: A0A1X9MH57
Position
complement(4468230..4469405)
Genome map
AA seq 391 aa AA seqDB search
MRTVIVSGARTPFAKFGGALKDMTASELGGYAIRETLKRANWSSEQVDEVIMGNVLQAGQ
GQIPSRQAAHIAGLPWTVKTETINKVCASGMRSVTLSDRAIRLGEADVVIAGGMESMSNA
PYYLPNARWGSRMGHSEMIDGLIYDGLTCSFTGVHMGTYGSKVARELEIKREEQDQWAYE
SHKRAMAAIESQRLANEIVAVPVPQRKGEPLMVDRDEAPRKDTSLDTLAKLKPVFSKDGT
ITAGNAPGVNDGAAALLLMSEQKAKQAGIKPLATIVAHTALATKPEDFPKTPGLVINQLL
NETGLQAEDISLFEINEAFAAVALASQKLASLDSKKINVNGGAVALGHPIGASGTRIILT
LAYELQRRGGGLGIAAICSGGGQGDAVLIEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtaattgtaagtggagcaaggaccccttttgcaaaatttggtggtgcgtta
aaagatatgacggcgtcagagcttggcggctatgcgattagggaaacattaaaacgagcc
aattggtctagtgagcaagttgatgaagtaattatgggcaatgttttgcaagctgggcaa
ggacaaattccttcgcggcaagctgctcatatagctggtctgccttggacagttaagacc
gaaacgattaacaaagtatgtgcttcaggaatgaggagtgtcactcttagtgatcgagcg
attcgattaggagaggcggatgtggtgattgctggcggtatggaatcaatgagtaatgct
ccctattatcttccaaacgcaagatggggatcgaggatgggccatagtgagatgattgac
gggctcatttatgatggcttaacttgttcctttacaggcgtgcatatgggcacatacgga
agtaaggttgcccgtgagttggaaattaagagagaagagcaagatcaatgggcttacgaa
agccataaaagagcgatggcagcgattgaatctcagagactagcaaatgaaattgttgct
gtacctgtgccacagcgaaaaggagaaccgctaatggtcgatcgtgatgaagctccgcga
aaggatacatcgcttgacacacttgcaaagctgaaacctgtattttcaaaggatgggaca
attacagcagggaatgcaccaggagttaatgacggagcggcggcactgttgttaatgtcg
gaacaaaaagcgaaacaagctgggatcaagccgctagcaacgattgtagctcacacggct
ttagcgacgaaacctgaggattttccgaaaacgccaggactagtgatcaaccagttgtta
aacgaaacaggtttacaggcagaagatatttccctttttgaaattaacgaagcatttgca
gccgtagcgttagcgagtcagaaactcgcttctcttgattcaaagaagatcaatgtcaac
ggtggggcagtggcacttggtcatccaattggagcgagtgggacacgaatcattttgaca
cttgcctatgagttacagcgtaggggcggaggacttggaatagcagcaatttgtagcggc
ggtggtcaaggtgacgcagtactaattgaagtctag

DBGET integrated database retrieval system