KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_0497Help
Entry
BLA_0497          CDS       T00819                                 

Gene name
ileS
Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLA_0497 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bla01007]
    BLA_0497 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bla03016]
    BLA_0497 (ileS)
Enzymes [BR:bla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     BLA_0497 (ileS)
Amino acid related enzymes [BR:bla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BLA_0497 (ileS)
Transfer RNA biogenesis [BR:bla03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BLA_0497 (ileS)
 Prokaryotic Type
   Other AARSs
    BLA_0497 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ACL28796
UniProt: B8DWE5
Position
complement(619659..622982)
Genome map
AA seq 1107 aa AA seqDB search
MVSETPQHVYPKASVGEQSANVAPNPDFPQLEQDVLRYWDTNGTFQKSIDENPSGEHSSN
EFVFFDGPPFANGLPHYGHLLTGYAKDVVPRYQTMKGRRVNRVFGWDTHGLPAELEAQKE
LGIDSVDQIEQMGIDKFNDACRASVLKYVNEWRDYVHRQARWVDFEHGYKTLDIPYMESV
MWAFKTLYEKGLAYKGYRVLPYCPKDQTPLSAHELRMDADVYQDRQDTTVSVAVKLRDED
DAYAVFWTTTPWTVPTNFAIVVGADIDYVEVRPKEGKFAGKKFYFAKALLGSYNKELGED
YEVVRELKGSDMVGWRYYPVFPYFAGEQATAEGGTPGPNAYQILTADYVDTTEGTGLVHQ
APYGEDDMNTLNAHGIASVDVLDSGCRFTSLCPDYEGMFVFDANLPILRNLRAGDGPLAE
RPESERALLFQEKSYVHSYPHCWRCGTPLIYKPVSSWFVSVTKIKPRLLELNQQINWIPE
NVKDGQFGKWLANARDWSISRNRFWGSPIPVWVSDDPKYPRVDVYGSLDELKRDFGDYPR
DKDGNINMHRPWIDNLTRPNPDDPTGKSTMHRITDVLDCWFESGSMPFAQYHYPFENKEY
FEHHFPSDFIVEYIGQTRGWFYLLHVMATALFDKPAFKNVICHGIVLGDDGQKMSKHLRN
YPDVNGVFDKYGSDAMRWFLMSSPILRGGNLIVTEDGIRDTVRQIMLPVWSSYYFFTLYA
NAANHGDGYDARTLRADEVPGLPQMDRYLLARTRKLIANVTEHMDNFEISDACDEVADFI
DMLTNWYIRNTRDRFWNEDENAFNTLYTVLEAFMRVLAPLAPMEAEAVWRGLTGGDSVHL
GDWPYLTDPQTGVDTALGKVLVEDGALVEAMDKVREIVSSTLSLRKAHKMRVRQPLAKLT
VVVDDPSQVDGYDALLKSELNIKAIDYSTLDEAAEHGLKIIDELKVNARAAGPRLGKQVQ
FAIKASKSGDWHADPVTGDPVIETPNGEITLQGDEYDITRRVEEADATARRDSASSILPS
GGFVILDLELTGDLIAEGYARDVVRAVQDARKEAGLEVSDRIALTLTVPSGDLPKVEQFR
DLICSETLSTSMQVEQGDALGVHVAKA
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcgaaacaccacagcacgtgtatcccaaggcatcggtcggcgaacaaagcgcg
aacgtcgcgccgaatcccgacttcccgcagctcgaacaagatgtgctgcgttattgggac
accaacggcaccttccagaaatccatcgacgaaaaccccagtggtgagcacagctcgaat
gagttcgtgttcttcgacggcccgccctttgcgaacggactgccgcactacggccatctg
ctcaccggctacgccaaagacgtggtgccgcgctaccagaccatgaagggccggcgcgtc
aaccgcgtgttcggctgggacacgcacggcctgcccgccgaacttgaagcgcagaaggag
ctcggcatcgactcggtcgaccagatcgagcagatgggcatcgacaaattcaacgacgcc
tgccgcgcctccgtgctcaaatacgtgaacgaatggcgtgactatgtgcaccgccaggcg
cgctgggtcgattttgaacacggctacaagacactcgacatcccgtacatggagtcggtc
atgtgggcgttcaagacgctgtacgagaaaggcctggcatacaagggctaccgcgtgctg
ccgtactgcccgaaggaccagacgccgctgtccgcgcacgagctgcgcatggacgccgac
gtgtaccaggaccgtcaggacacgaccgtttcggtcgcggtgaagctgcgtgacgaagac
gacgcctacgcggtgttctggaccaccactccgtggaccgtgcccacgaacttcgcgatt
gtggtgggcgccgacatcgattacgtggaggtgcgccccaaggaaggcaagttcgccggc
aagaagttctacttcgccaaggccttgctcggttcctacaacaaggagctcggcgaggac
tatgaggtggtgcgcgagctcaagggctccgacatggtgggctggcgctactacccggtc
ttcccgtatttcgcgggcgagcaggccacggccgaaggcggcacccccggtccgaacgcc
taccagatcctgaccgccgattacgtcgacaccacggaaggcaccggcttggtgcatcag
gcaccatacggcgaagacgatatgaacacgctcaacgcccacggcatcgcgagcgtcgat
gtgctcgactctggctgccgcttcacgtcgctgtgcccggactacgaaggcatgttcgtg
ttcgatgcgaatctgccgatcctgcgcaatctgcgcgccggtgacggtccgctcgccgag
cgtccggagtccgagcgcgcgttgctgttccaggagaagagctacgtgcactcctacccg
cactgctggcgttgcggcacaccgctcatctacaagccggtctccagctggttcgtgagc
gtgaccaagatcaagccgcgcctgctcgaactcaatcagcagatcaactggattccggag
aacgtgaaggacggccagttcggcaagtggctcgccaatgcgcgcgactggtcgatctcg
cgcaaccggttctggggttcgccaatcccggtgtgggtgagtgacgacccgaagtacccg
cgtgtggacgtgtacggttcgctcgacgagctcaagcgtgacttcggcgactacccgcgt
gacaaggacggcaacatcaacatgcaccgcccgtggatcgacaatctcacgcgcccgaac
ccggacgacccgaccggcaagtccacgatgcaccgcatcaccgatgtgctcgactgctgg
ttcgagtccggttccatgccgttcgcgcagtaccactacccgttcgagaacaaggagtac
ttcgagcaccacttcccgagcgacttcattgtcgaatacattggccagacccgtggttgg
ttctacctgctgcatgtcatggcgaccgcgctgttcgacaagccggcgttcaagaacgtg
atctgccatggcattgtgctcggagacgacggtcagaagatgagcaagcatctgcgcaac
tacccggatgtgaacggcgtgttcgacaagtatggttccgacgcgatgcgctggttcctg
atgagctcgccgattctgcgtggcggcaacctcatcgtgacggaggacggcattcgcgac
acggtgcgccagatcatgctgccggtgtggagctcgtattacttcttcacgctgtatgcc
aatgcggcgaaccacggcgatggctatgacgcgcgcacgctgcgtgccgacgaggtgccc
ggtctgccgcagatggaccgctatctgctcgcccgcacgcgcaaactcattgcgaacgtg
accgagcatatggacaacttcgagatttccgatgcctgcgacgaggtggcggatttcatc
gacatgctcacgaattggtacattcgcaatacccgcgaccgcttctggaacgaggatgag
aacgcgttcaacacgttgtatacggtgcttgaggcgttcatgcgcgtgcttgccccgctc
gccccgatggaggcggaggccgtgtggcgtggtctgaccggcggtgactcggtgcacttg
ggtgactggccgtatctgactgatccgcagaccggtgtggataccgcgctcggcaaggtg
ctcgttgaagacggcgcgctggtcgaggcgatggacaaggtgcgcgagatcgtttcgtcc
acgctgtcgctgcgcaaggcgcataagatgcgcgtgcgccagccgctcgccaagctcacc
gtggtcgtcgacgatccttcgcaggtcgatggatatgacgcgttgctcaagagcgagctc
aacatcaaggcgatcgactattcgacgctggatgaggccgccgagcatggtctgaagatc
atcgacgagctcaaggtgaatgcgcgtgccgccggccctcgcctgggcaagcaggtgcag
ttcgcgatcaaggcgtcgaagagcggtgactggcatgccgaccctgtaaccggcgacccg
gtgatcgagacgccgaacggcgagatcacgctgcagggcgacgaatacgacatcacccga
cgcgtggaagaggcggacgccacggcacggcgcgattccgcatcgtcgatcctgcccagt
ggtggattcgtgatcctcgatctggagctcaccggtgacctgatcgccgaaggctatgcg
cgagacgtggtccgcgcggtgcaggatgcgcgcaaggaggccggcctcgaggtgtccgac
cgcatcgcgctcacgctcacggtgccttccggtgacctgccgaaggtggagcagttccgc
gacctgatctgctcggagacgctgtccacgtcgatgcaggttgagcaaggcgacgccctc
ggggtgcatgtggccaaggcgtga

DBGET integrated database retrieval system