KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_1271Help
Entry
BLA_1271          CDS       T00819                                 

Definition
(GenBank) possible phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Brite
Enzymes [BR:bla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BLA_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACL29559
UniProt: B8DU80
Position
1606089..1606721
Genome map
AA seq 210 aa AA seqDB search
MQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQLVVSSDLERSMQTAHAFADRLGS
EVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCRGMGGEMNHGAESHEHAGVRSMEA
MNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRYPDFTLTSMCNAHWARLRRADIDM
DSRWIMEDYNHGPALADTQYWERPDTLPAK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcagggatcgatcgacattccgctcgatgaggtcgggctgtggcaggtgaaccagtcc
gcgcagtcactgattaagctatatgtgctcccagacccatctcggcaccagctcgttgtg
tcctccgacctcgaacgttcgatgcagacggcacatgccttcgccgatagactggggtcc
gaagtgcatgccgacgaacggttgcgcgagcggcatttcggtgaattcgaaggccgatcc
ggcgcatacctgcaggccaatttcccgcaggacttcgactcgtggtgccggggcatgggc
ggcgagatgaatcatggcgccgaatcccacgaacatgccggtgtccgcagcatggaggcc
atgaatgattgggcccatgaatgcgatgacgacaccgacttgttcgtattctcccatggc
gcgctcatcgaaaacgcgctgcaggtgctgttcggcatcgaacgacgatacccggatttc
acgctcacctcgatgtgcaacgcgcactgggccagactgagaagggccgatatcgacatg
gacagccggtggatcatggaggactacaaccatggacccgccctggccgatacacagtat
tgggagcgcccagacactttgccagcgaaatga

DBGET integrated database retrieval system