KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_1348Help
Entry
BLA_1348          CDS       T00819                                 

Gene name
thrS
Definition
(GenBank) threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLA_1348 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bla01007]
    BLA_1348 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bla03016]
    BLA_1348 (thrS)
Enzymes [BR:bla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     BLA_1348 (thrS)
Amino acid related enzymes [BR:bla01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BLA_1348 (thrS)
Transfer RNA biogenesis [BR:bla03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BLA_1348 (thrS)
 Prokaryotic Type
    BLA_1348 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD
Motif
Other DBs
NCBI-ProteinID: ACL29633
UniProt: B8DUF4
Position
complement(1680953..1683031)
Genome map
AA seq 692 aa AA seqDB search
MAEAHISITVNGEAKEVEASQTGVELFADDKNIIAVRLNGELRDLYTPLHDGDNVESVTL
DSPDGTGIMRHSATHVMAQAVQEVRPDAKLGIGPVIENGFYYDFDVKDPFTPDDLKTIEK
HMQRIIKSAQRFQRRVVSEEEALREEADEPYKIELIKDKEDALETEAAVDISHKELSMYD
NLDREGNVVWSDLCRGPHLPNTRYIKAFKLERAAAAYWKGSEANPMLQRIYGVAFPTKDE
LKAYQTRMEEAAKRDHRKLGQEMDLFSFPDEIGPGLAVFHPKGAAIINAMEDYSREMHRK
NHYSFVQTPHITKGGLYETSGHLQWYKDGMYPPMHLDEEKDENGNIVKQGFDYYLKPMNC
PMHNLIFKSRQRSYRELPLRLFEFGTVYRYEKSGVVHGLTRVRGLTQDDSHIYCTREQMK
DELKNLLNFVLKVLKDYGLNDFYLELSTKDEHKFVGSDEIWEEATNTLAEVAEESGLELV
ADPGGAAFYGPKISVQARDAIGRTWQVSTIQLDFNLPERFQLEYIAPDGSHQRPVMIHRA
LFGSIERFFAILLEHYAGAFPAWLAPVQALGVPVADEFAPHLDKFMNSLEEDLVRVETDN
SDDRFGKKIRNASKSKVPYIIIAGEEDMNNNAVSFRFRDGSQLNGVPVDQAKAWILETIT
KRVQVNSVDDFKAATGQPVENVEFGVADTDAE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcacacatctccatcacagtcaacggcgaggcgaaggaggtggaagcaagc
cagaccggcgtcgaactgttcgcagacgacaagaacatcatcgcagtgcgtctcaatggc
gagttgcgagacctctacacgcctctgcacgatggcgacaacgtcgaatccgtgaccctc
gactcgccggatggcacaggcatcatgcgccattcggccacccatgtcatggcacaggcc
gtgcaggaggtacgcccggatgccaagctcggcattggcccggtgatcgagaacggtttc
tactacgacttcgacgtgaaggatccattcacgccggatgacctgaagaccatcgaaaag
cacatgcaacgcatcatcaagtcggcgcagcgcttccagcgccgagtggtgagcgaagag
gaggccctgcgcgaagaggctgatgagccgtacaagatcgagctcatcaaagacaaggaa
gatgcgctcgagaccgaggcggccgtagacatcagccataaggagctgagtatgtacgac
aatctcgaccgtgagggcaatgtggtgtggtcggatctctgccgtggaccgcacctgccg
aacacccgctatatcaaggcattcaagctggagcgcgccgccgccgcgtattggaagggt
tcggaggcgaaccccatgctccagcgcatctacggcgtggcgttccccaccaaggacgag
ctcaaggcctaccagacccgcatggaggaggccgccaaacgcgaccaccgcaaactcggt
caggaaatggacctgttctcgttccctgacgagatcggcccgggtcttgccgtgttccat
ccaaagggcgccgcgattatcaacgcgatggaggactactcccgcgagatgcaccgcaag
aatcactacagcttcgtgcagactccgcacatcaccaagggcggcctgtatgagacgtcc
ggacacctgcagtggtacaaggacggcatgtatccgccgatgcatctggatgaggaaaag
gacgagaacggcaacatcgtcaagcagggcttcgactattacctcaagccgatgaactgc
ccgatgcacaacctcatcttcaagtcacgccagcgttcctaccgagaactgccgttgcgc
ctcttcgagttcggcaccgtctaccgctacgagaagtccggcgtggttcacggactgacc
cgcgtgcgcggtctgactcaggatgattcccacatctactgcacccgtgagcagatgaag
gacgagctcaagaacctgctcaacttcgtgctcaaagtgctcaaggactatggtctcaac
gatttctacttggagctttccacgaaggacgagcacaagttcgtcggctccgacgagatc
tgggaggaggcgaccaacaccctcgccgaggtggccgaggaatccggtctcgaactcgtg
gcggatccgggtggcgccgcattctatggtccgaagatctcggtgcaggcccgcgacgca
atcggacgcacttggcaggtctccacgattcagctcgacttcaatctgccggagcgtttc
cagttggagtacatcgctccggatggatcgcaccagcgccccgtaatgatccatcgtgcg
ttgttcggttccatcgagcgtttcttcgcgattctgctcgagcactatgccggcgccttc
ccggcgtggctggctcccgtgcaggctctcggtgtgccggtggcggacgaattcgccccg
catctcgacaagttcatgaattcgctcgaagaggaccttgtgcgcgtcgagaccgacaat
tccgatgatcgtttcggcaagaagatccgcaacgcctccaaatcgaaagtgccgtacatc
atcatcgccggcgaggaggatatgaacaacaacgccgtgagcttccgcttccgtgacggc
agccaactcaacggcgtgccggtcgaccaagccaaggcgtggattctggagacgatcacc
aagcgtgtgcaggtcaacagcgtcgacgacttcaaggcagccaccgggcagcctgtggag
aatgtcgagttcggcgtcgcagacaccgacgccgagtaa

DBGET integrated database retrieval system