KEGG   Bifidobacterium animalis subsp. lactis AD011: BLA_1485Help
Entry
BLA_1485          CDS       T00819                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bla  Bifidobacterium animalis subsp. lactis AD011
Pathway
bla00430  Taurine and hypotaurine metabolism
bla00620  Pyruvate metabolism
bla00640  Propanoate metabolism
bla00680  Methane metabolism
bla01100  Metabolic pathways
bla01120  Microbial metabolism in diverse environments
bla01200  Carbon metabolism
Module
bla_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLA_1485 (ackA)
   00640 Propanoate metabolism
    BLA_1485 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BLA_1485 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BLA_1485 (ackA)
Enzymes [BR:bla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BLA_1485 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ACL29767
UniProt: B8DUT8
Position
1838258..1839490
Genome map
AA seq 410 aa AA seqDB search
MAKTVLVINSGSSSIKYQLVDLESGEGIASGIVEKIGEPIDGHYKYEYNGEKHELDEKVE
NHEQGLKRVLGFFEEYGPSLEETGIIAVGHRVVQGGDTFPNPALVTPDTTAKVEELAVLA
PLHNGPEAKGARVMRELLPEIPQVYVFDSSFFQQLPKASSTYALNKEVADKYKIKRYGAH
GTSHWFVSSQIPEFLGIDAEAAKGLKQIVLHIGNGASASAELGGRPIETSMGLTPLEGLV
MGSRTGDIDPAAVFHLMRNADMNVDELDDLFNKKSGMMGMTGFGDMREVHRLVAEGDENA
KLALDIYVHRIVSYIGAYTAQLGGLDVLTFTAGVGENDEIVRRMVCEKLAPFGVKLDNDK
NDTRSKEPRIISTPDSTVTVVVYPTNEELAIAQRANEIVTAGEDTYGNKI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccgtccttgttatcaattcgggttctagctcgatcaagtaccagctggta
gatctcgagtccggcgaaggaatcgcatcgggtatcgtcgagaagatcggcgaaccgatt
gacggccactacaagtacgaatacaacggcgaaaagcacgagctcgacgagaaggtcgaa
aaccatgagcagggcctcaagcgcgtgctcgggttcttcgaggaatacggcccgagcctt
gaagagaccggcatcatcgccgtcgggcaccgagttgtccagggcggcgacaccttcccg
aaccctgccttggtgacccccgacaccactgccaaggtcgaggagctggctgtgctcgct
ccgctgcacaacggcccggaggccaagggggcgcgagtcatgcgcgagctgctccctgag
attccgcaggtttatgtcttcgactcctccttcttccagcagctgccgaaggcatcgagc
acctatgcgttgaacaaggaagtcgccgacaagtacaagatcaagcgttacggcgcacac
ggcacctcgcactggttcgtctcctcccagattccagagttcctcggcattgacgccgag
gccgccaagggcctcaagcagatcgtgctgcacatcggcaacggcgcctccgcctccgcg
gaactcggcggccgccccatcgagacctccatgggcctcaccccgctcgaaggcctcgtc
atgggctcccgaacgggcgacatcgatccagccgccgtgttccacctgatgcgcaatgcc
gatatgaatgtcgatgagctcgacgacctgttcaacaagaagtccggcatgatgggcatg
accggcttcggcgacatgcgcgaagtgcaccgcctcgttgcggaaggcgacgagaacgcc
aagctcgccctcgacatctacgtgcaccgcatcgtcagctacatcggcgcctacaccgca
cagctcggcggcctcgatgtgctcaccttcaccgccggtgtcggcgagaacgacgaaatc
gttcgccgcatggtgtgtgagaagctggcaccgttcggtgtcaagctcgacaacgacaag
aacgacacccgttcgaaggaaccgcgcattatctccacgccggattccactgtcaccgtc
gtcgtctaccccaccaatgaggagctcgccatcgcacagcgcgccaacgagatcgtcacc
gccggggaagacacctacggcaacaagatctga

DBGET integrated database retrieval system