KEGG   Blastochloris sp. GI: BLTE_03960Help
Entry
BLTE_03960        CDS       T05837                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
blag  Blastochloris sp. GI
Pathway
blag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:blag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLTE_03960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:blag02022]
    BLTE_03960
Two-component system [BR:blag02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BLTE_03960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: BBF91711
UniProt: A0A348FWM8
Position
450114..450824
Genome map
AA seq 236 aa AA seqDB search
MPRPIVVPPDDAPHLLVVDDDARILALLSRYLTENGYRVTTVASAADARARLESLSFDLL
VLDVMMPGESGLDLARSLRGKSDVPILMLTARTEPSERIAGFESGADDYLGKPFEPRELL
LRIGAILKRSTAPQPSKPPEVVCFGEFVFQLERGELRRGAELVRITDRERDMLRVLARTP
GETVPRIDLAAPGAEASERAVDVQVNRLRRKIEDDPANPLFIQTVRGVGYRLVVSP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgaccgatcgtggttcctcccgacgacgcgccccatctgctggtggtcgacgac
gacgcccgcatcctggcgctgctgtcgcgttacctcaccgagaacggctaccgcgtcacc
accgtggcctcggccgccgatgcgcgcgcgcgcctcgaaagcctgtcgttcgacctgctg
gtgctcgacgtgatgatgccgggcgagtcgggcctcgacctcgcccggtccttgcgcggc
aagtccgacgtgccgattttgatgctgaccgcgcgcaccgagccctccgagcgcatcgcc
ggtttcgaatccggcgccgacgactatctcggcaagccgttcgagccgcgcgagctcctg
ctgcgcatcggcgccatcctcaagcgcagcaccgcgccccagccctccaagccgcccgag
gtggtgtgcttcggcgagttcgtgttccagctcgagcgcggcgagctcaggcgcggcgcc
gagctggtgcgcatcaccgaccgcgagcgcgacatgctccgcgtgctggcgcgcaccccc
ggcgagaccgtgccgcgcatcgacctcgccgcgccgggcgccgaggccagcgagcgcgcg
gtggacgtgcaggtcaaccggctgcgccgcaagatcgaggacgatccggccaacccgctg
ttcatccagacggtgcgcggcgtcggctatcgcctcgtcgtgtcgccgtga

DBGET integrated database retrieval system