KEGG   Blastochloris sp. GI: BLTE_04470Help
Entry
BLTE_04470        CDS       T05837                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
blag  Blastochloris sp. GI
Pathway
blag00020  Citrate cycle (TCA cycle)
blag00620  Pyruvate metabolism
blag00650  Butanoate metabolism
blag01100  Metabolic pathways
blag01110  Biosynthesis of secondary metabolites
blag01120  Microbial metabolism in diverse environments
blag01130  Biosynthesis of antibiotics
blag01200  Carbon metabolism
Module
blag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:blag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLTE_04470
   00620 Pyruvate metabolism
    BLTE_04470
   00650 Butanoate metabolism
    BLTE_04470
Enzymes [BR:blag01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BLTE_04470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans DUF4423
Motif
Other DBs
NCBI-ProteinID: BBF91762
UniProt: A0A348FWS9
Position
506328..507842
Genome map
AA seq 504 aa AA seqDB search
MTDSNRIACNRLRSKVMSADDAARFIESGTTVGMSGFTGSGYPKAVPVALATRIDAEHDA
GRPFRVRVWTGASTGPELDGALAKVDAIEFRLPYNSDPTVRDKINRGQMEYFDMHLSQVA
PVAWQGFLGPLDTAVVEITAIRPDGSLVPSTSVGNNKTWLERASKVILEVNSWQNAALEG
MHDIYYGTALPPHRSPIPLIRPDGRIGQPTLRVDPDKIVAIVETHAPDRNLPFSQPDEVA
YAIAGHIIEFLQHEVKKGRLPHELLPLQSGVGNIPNAVLKGLLDAPFENMTSYTEVVQDG
MLDLLETGKLRMASATAFSLSPDAAEKLNANLERFRNKIILRPQEISNHPEVIRRLGCIA
MNGLIEADIYGNVNSTHVMGSRIQNGIGGSGDFARNAYVSIFMTPSTAKGGKISAIVPQC
SHVDHINQDVQVIVTEYGLADLRGLSPKQRAETIIAKCAHPDYRPALADYFKRAREHSYG
QHAPALLTESLSWHQRFIETGSMK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgacggactcaaatagaattgcttgcaaccgtctgcgctccaaggtgatgagcgccgac
gacgcggccagattcatcgaatccggcacgaccgtgggcatgagcggcttcaccggctct
ggctatcccaaggcggtgccggtggcgctggccacccgcatcgacgccgagcacgatgcc
ggccggccgttccgggtgcgggtgtggaccggcgcctccaccggccccgagctcgacggc
gcgctggccaaggtcgacgccatcgagttccgcctgccgtacaattccgatcccaccgtc
cgcgacaagatcaaccgcggccagatggaatatttcgacatgcacctgagccaggtcgcg
ccggtggcgtggcagggcttcctcgggccgctggacaccgcggtggtcgagatcaccgcg
atccgccccgacggctcgctggtgccctcgacctcggtcggcaacaacaagacgtggctg
gagcgggcgagcaaggtcatcctggaggtcaactcctggcagaacgccgcgctcgagggc
atgcacgacatctattacggcacggcgctgccgccgcaccgctcgccgatcccgctgatc
cggccggacggccgcatcggccagccgacgctgcgcgtcgaccccgacaagatcgtcgcc
atcgtcgagacccacgcgcccgaccgcaacctgccgttctcgcagcccgacgaggtggcc
tacgcgatcgccggccacatcatcgagttcctgcagcacgaggtgaagaagggccgcctg
ccgcacgagctgctgccgctgcagtcgggcgtcggcaacattcccaatgcggtgctgaag
ggcctgctcgacgcgccgttcgagaacatgacctcctacaccgaggtggtgcaggacggc
atgctcgacctgctggagaccggcaagctgcgcatggcctcggccaccgccttctcgctg
agccctgacgcggccgagaagctcaacgccaatctggagcgcttccgcaacaagatcatc
ctgcggccgcaggagatctccaaccaccccgaggtgatccgccgcctcggctgcatcgcc
atgaacgggctgatcgaggccgacatctacggcaacgtcaattcgacgcacgtcatgggc
tcgcgcatccagaacggcatcggcggctcgggcgacttcgcccgcaacgcctatgtgtcg
atcttcatgacgccgtcgaccgccaagggcggcaagatctcggccatcgtgccgcagtgc
agccatgtcgaccacatcaaccaggacgtccaggtgatcgtcaccgaatacggcctggcg
gatctgcgcggcctgtcgcccaagcagcgcgccgagacgatcatcgccaagtgcgcgcat
ccggactaccgcccggcgctggccgactatttcaagcgcgcccgggaacacagctacggc
cagcatgcgccggcgctgctgacggaatcgctgtcctggcaccagcgcttcatcgagacc
ggctcgatgaagtga

DBGET integrated database retrieval system