KEGG   Blastochloris sp. GI: BLTE_17790Help
Entry
BLTE_17790        CDS       T05837                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
blag  Blastochloris sp. GI
Pathway
blag03010  Ribosome
Brite
KEGG Orthology (KO) [BR:blag00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLTE_17790 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:blag03011]
    BLTE_17790 (rplV)
Ribosome [BR:blag03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BLTE_17790 (rplV)
  Bacteria
    BLTE_17790 (rplV)
  Archaea
    BLTE_17790 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TniB
Motif
Other DBs
NCBI-ProteinID: BBF93094
UniProt: A0A348G0L1
Position
complement(1913545..1913934)
Genome map
AA seq 129 aa AA seqDB search
MGKPARERTLNDSEAMASARNLRVSPQKLNLVAGLIRGKRVTSALADLEFSKKRIARDVR
KCLESAIANAENNHGLDVDDLVVADAHVGKSMVIKRFVPRGRGRVGRIFKAFSNITIVVR
QVEAAPASE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagccggcgcgcgagcgcactctcaatgatagcgaagcgatggcttcggcgcgc
aatctgcgcgtcagcccgcagaagctcaatctggtggcgggcctgatccgcggcaagcgg
gtcacgagcgcgctggcggatctcgaattctccaagaagcggatcgcccgcgacgtccgc
aagtgcctggagtcggccatcgccaacgccgagaacaatcacgggctcgacgtcgatgat
ctggtcgttgccgacgcgcatgtcggcaagtctatggtcatcaagcgcttcgtgccccgt
ggccgcggccgcgtgggccgcatcttcaaggcgttctcgaacatcaccatcgtcgtccgc
caggtcgaggcggcgccggcctccgagtga

DBGET integrated database retrieval system